Cercocebus atys (sooty mangabey): 105589372 Help Entry 105589372         CDS       T07242                                  Symbol CCL2 Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04060   Cytokine-cytokine receptor interaction caty04061   Viral protein interaction with cytokine and cytokine receptor caty04062   Chemokine signaling pathway caty04621   NOD-like receptor signaling pathway caty04657   IL-17 signaling pathway caty04668   TNF signaling pathway caty04933   AGE-RAGE signaling pathway in diabetic complications caty05135   Yersinia infection caty05142   Chagas disease caty05144   Malaria caty05163   Human cytomegalovirus infection caty05164   Influenza A caty05168   Herpes simplex virus 1 infection caty05171   Coronavirus disease - COVID-19 caty05323   Rheumatoid arthritis caty05417   Lipid and atherosclerosis caty05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     105589372 (CCL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105589372 (CCL2)    04061 Viral protein interaction with cytokine and cytokine receptor     105589372 (CCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105589372 (CCL2)    04657 IL-17 signaling pathway     105589372 (CCL2)    04062 Chemokine signaling pathway     105589372 (CCL2)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     105589372 (CCL2)    05164 Influenza A     105589372 (CCL2)    05168 Herpes simplex virus 1 infection     105589372 (CCL2)    05163 Human cytomegalovirus infection     105589372 (CCL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     105589372 (CCL2)   09174 Infectious disease: parasitic    05144 Malaria     105589372 (CCL2)    05142 Chagas disease     105589372 (CCL2)   09163 Immune disease    05323 Rheumatoid arthritis     105589372 (CCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105589372 (CCL2)    05418 Fluid shear stress and atherosclerosis     105589372 (CCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     105589372 (CCL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105589372 (CCL2)    00536 Glycosaminoglycan binding proteins [BR:caty00536]     105589372 (CCL2) Cytokines and neuropeptides [BR:caty04052]  Cytokines   Chemokines    105589372 (CCL2) Glycosaminoglycan binding proteins [BR:caty00536]  Heparan sulfate / Heparin   Chemokines    105589372 (CCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 GPR15L CXCL16 Motif Other DBs NCBI-GeneID:  105589372 NCBI-ProteinID:  XP_011923180 Ensembl:  ENSCATG00000043802 UniProt:  A0A2K5NYE4 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKVSAALLCLLLIAATFSPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQIQTPKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaagtctctgcagcacttctgtgcctgctgctcatagcagccaccttcagcccccag gggctcgctcagccagatgcaatcaatgcccccgtcacttgctgctataacttcaccaat aggaagatctcagtgcagaggctggcgagctatagaagaatcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag aagtgggttcaggattccatggaccacctggacaagcaaatccaaactccgaagccttga

DBGET integrated database retrieval system