Cercocebus atys (sooty mangabey): 105591326 Help Entry 105591326         CDS       T07242                                  Name (RefSeq) interferon alpha-1/13   KO K05414   interferon alpha Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04060   Cytokine-cytokine receptor interaction caty04151   PI3K-Akt signaling pathway caty04217   Necroptosis caty04620   Toll-like receptor signaling pathway caty04621   NOD-like receptor signaling pathway caty04622   RIG-I-like receptor signaling pathway caty04623   Cytosolic DNA-sensing pathway caty04630   JAK-STAT signaling pathway caty04650   Natural killer cell mediated cytotoxicity caty04936   Alcoholic liver disease caty05152   Tuberculosis caty05160   Hepatitis C caty05161   Hepatitis B caty05162   Measles caty05163   Human cytomegalovirus infection caty05164   Influenza A caty05165   Human papillomavirus infection caty05167   Kaposi sarcoma-associated herpesvirus infection caty05168   Herpes simplex virus 1 infection caty05169   Epstein-Barr virus infection caty05170   Human immunodeficiency virus 1 infection caty05171   Coronavirus disease caty05200   Pathways in cancer caty05320   Autoimmune thyroid disease caty05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105591326    04151 PI3K-Akt signaling pathway     105591326   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105591326  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105591326  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105591326    04621 NOD-like receptor signaling pathway     105591326    04622 RIG-I-like receptor signaling pathway     105591326    04623 Cytosolic DNA-sensing pathway     105591326    04650 Natural killer cell mediated cytotoxicity     105591326  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105591326   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105591326    05161 Hepatitis B     105591326    05160 Hepatitis C     105591326    05171 Coronavirus disease     105591326    05164 Influenza A     105591326    05162 Measles     105591326    05168 Herpes simplex virus 1 infection     105591326    05163 Human cytomegalovirus infection     105591326    05167 Kaposi sarcoma-associated herpesvirus infection     105591326    05169 Epstein-Barr virus infection     105591326    05165 Human papillomavirus infection     105591326   09171 Infectious disease: bacterial    05152 Tuberculosis     105591326   09163 Immune disease    05320 Autoimmune thyroid disease     105591326   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105591326   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105591326  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105591326 Cytokines and neuropeptides [BR:caty04052]  Cytokines   Interferons    105591326 SSDB OrthologParalogGFIT Motif Pfam:  Interferon iSTAND Motif Other DBs NCBI-GeneID:  105591326 NCBI-ProteinID:  XP_011927329 UniProt:  B6CK05 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MALPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTMMLLAQMSRISPSSCLMDRHDFG FPQQEFDGNQFQKAPAVSVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLE ACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTK LQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcactgccctttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc tctctgggctgtgatctgcctgagacccacagcctggataacaggaggaccatgatgctc ctggcacagatgagcagaatctctccttcctcctgtctgatggacagacatgactttgga tttccccagcaggagtttgatggcaaccagttccagaaggctccagccgtctctgtcctc catgagctgatccagcagaccttcaacctctttaccacaaaagactcatctgctgcttgg gatgaggacctcctagacaaattctgcactgaactctaccagcagctgaacgacttggaa gcctgtgtgatgcagcaggagagggtgggagaaactcctctgatgaatgcggactccacc ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaacaaag ttgcaagaaagattaaggaggaaggaataa

DBGET integrated database retrieval system