Cercocebus atys (sooty mangabey): 105593014 Help Entry 105593014         CDS       T07242                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04010   MAPK signaling pathway caty04020   Calcium signaling pathway caty04022   cGMP-PKG signaling pathway caty04114   Oocyte meiosis caty04218   Cellular senescence caty04310   Wnt signaling pathway caty04360   Axon guidance caty04370   VEGF signaling pathway caty04380   Osteoclast differentiation caty04625   C-type lectin receptor signaling pathway caty04650   Natural killer cell mediated cytotoxicity caty04658   Th1 and Th2 cell differentiation caty04659   Th17 cell differentiation caty04660   T cell receptor signaling pathway caty04662   B cell receptor signaling pathway caty04720   Long-term potentiation caty04724   Glutamatergic synapse caty04921   Oxytocin signaling pathway caty04922   Glucagon signaling pathway caty04924   Renin secretion caty05010   Alzheimer disease caty05014   Amyotrophic lateral sclerosis caty05020   Prion disease caty05022   Pathways of neurodegeneration - multiple diseases caty05031   Amphetamine addiction caty05152   Tuberculosis caty05163   Human cytomegalovirus infection caty05166   Human T-cell leukemia virus 1 infection caty05167   Kaposi sarcoma-associated herpesvirus infection caty05170   Human immunodeficiency virus 1 infection caty05235   PD-L1 expression and PD-1 checkpoint pathway in cancer caty05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105593014 (PPP3R2)    04310 Wnt signaling pathway     105593014 (PPP3R2)    04370 VEGF signaling pathway     105593014 (PPP3R2)    04020 Calcium signaling pathway     105593014 (PPP3R2)    04022 cGMP-PKG signaling pathway     105593014 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105593014 (PPP3R2)    04218 Cellular senescence     105593014 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105593014 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     105593014 (PPP3R2)    04660 T cell receptor signaling pathway     105593014 (PPP3R2)    04658 Th1 and Th2 cell differentiation     105593014 (PPP3R2)    04659 Th17 cell differentiation     105593014 (PPP3R2)    04662 B cell receptor signaling pathway     105593014 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     105593014 (PPP3R2)    04921 Oxytocin signaling pathway     105593014 (PPP3R2)    04924 Renin secretion     105593014 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     105593014 (PPP3R2)    04720 Long-term potentiation     105593014 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     105593014 (PPP3R2)    04380 Osteoclast differentiation     105593014 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105593014 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105593014 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     105593014 (PPP3R2)    05163 Human cytomegalovirus infection     105593014 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     105593014 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     105593014 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     105593014 (PPP3R2)    05014 Amyotrophic lateral sclerosis     105593014 (PPP3R2)    05020 Prion disease     105593014 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     105593014 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     105593014 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105593014 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:caty01009]     105593014 (PPP3R2) Protein phosphatases and associated proteins [BR:caty01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105593014 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_FSTL1 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  105593014 NCBI-ProteinID:  XP_011931170 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MSTMGNEASYPAEMCAHFDNDEIKRLGRRFRKLDLDKSGSLSVEEFMSLPELRHNPLVRR VIDVFDTNDDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK MMVGNNLPDWQLQQLVDKTILILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtccacaatgggaaacgaggccagttacccggcggagatgtgcgcccactttgacaat gatgaaattaaaaggctgggcaggaggtttcggaagttggacttggacaaatcaggctct ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga gtgatcgacgtcttcgacaccaacgacgatggagaagtggacttcaaggaattcatcctg gggacctctcagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgtttagc atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag atgatggtgggcaacaacctgccggactggcagctccagcagctggtcgacaaaaccatc ctcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system