Cercocebus atys (sooty mangabey): 105593174 Help Entry 105593174         CDS       T07242                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04613   Neutrophil extracellular trap formation caty05034   Alcoholism caty05203   Viral carcinogenesis caty05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:caty00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105593174  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105593174   09163 Immune disease    05322 Systemic lupus erythematosus     105593174   09165 Substance dependence    05034 Alcoholism     105593174  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:caty03036]     105593174 Chromosome and associated proteins [BR:caty03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105593174 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  105593174 NCBI-ProteinID:  XP_011931486 Ensembl:  ENSCATG00000016566 UniProt:  A0A2K5KNY8 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggcaaaggcgggaagggtcttggcaaaggcggcgctaagcgccaccgc aaggtgctgcgtgacaacatccagggcatcaccaagccggccatccggcgccttgcccgc cgcggcggcgtgaagcgcatctctggcctcatctacgaggagacccgtggggtgctgaaa gtcttcctggagaacgtgatccgggacgctgtgacctacacggagcatgccaagcgcaag acggtcaccgccatggatgtggtttacgcgctgaagcgccagggtcgcaccctctacggt ttcggcggttaa

DBGET integrated database retrieval system