Cercocebus atys (sooty mangabey): 105595298 Help Entry 105595298         CDS       T07242                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04010   MAPK signaling pathway caty04014   Ras signaling pathway caty04015   Rap1 signaling pathway caty04024   cAMP signaling pathway caty04072   Phospholipase D signaling pathway caty04137   Mitophagy - animal caty04140   Autophagy - animal caty04218   Cellular senescence caty04360   Axon guidance caty04371   Apelin signaling pathway caty04625   C-type lectin receptor signaling pathway caty04810   Regulation of actin cytoskeleton caty05132   Salmonella infection caty05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105595298 (RRAS)    04014 Ras signaling pathway     105595298 (RRAS)    04015 Rap1 signaling pathway     105595298 (RRAS)    04371 Apelin signaling pathway     105595298 (RRAS)    04072 Phospholipase D signaling pathway     105595298 (RRAS)    04024 cAMP signaling pathway     105595298 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105595298 (RRAS)    04137 Mitophagy - animal     105595298 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     105595298 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105595298 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105595298 (RRAS)   09158 Development and regeneration    04360 Axon guidance     105595298 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105595298 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105595298 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:caty04031]     105595298 (RRAS) GTP-binding proteins [BR:caty04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105595298 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  105595298 NCBI-ProteinID:  XP_011936276 Ensembl:  ENSCATG00000007379 UniProt:  A0A2K5KLL9 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLEAQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcgggggacctggg cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actattgaggactcctacacgaagatctgcagtgtggatgggatcccggcccggctggac atcctggacactgcgggccaggaggagttcggggccatgagagagcagtacatgcgtgcc ggccatggcttcctgctggtgtttgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacgcagattctccgggtcaaggaccgcgatgacttccccgtcgtgttggtc gggaacaaggcggatctggaggcacagcgccaggtcccccgatcagaagcatctgccttc ggcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgtctcaacgtggac gaggcttttgagcagctggtgcgggctgtccggaaataccaggaacaagagctcccaccc agccctcccagtgcccccaggaagaagggcgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system