Cercocebus atys (sooty mangabey): 105595718 Help Entry 105595718         CDS       T07242                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04010   MAPK signaling pathway caty04014   Ras signaling pathway caty04024   cAMP signaling pathway caty04072   Phospholipase D signaling pathway caty04137   Mitophagy - animal caty04140   Autophagy - animal caty04218   Cellular senescence caty04371   Apelin signaling pathway caty04625   C-type lectin receptor signaling pathway caty04810   Regulation of actin cytoskeleton caty05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105595718 (RRAS2)    04014 Ras signaling pathway     105595718 (RRAS2)    04371 Apelin signaling pathway     105595718 (RRAS2)    04072 Phospholipase D signaling pathway     105595718 (RRAS2)    04024 cAMP signaling pathway     105595718 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105595718 (RRAS2)    04137 Mitophagy - animal     105595718 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     105595718 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105595718 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105595718 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105595718 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caty04147]     105595718 (RRAS2)    04031 GTP-binding proteins [BR:caty04031]     105595718 (RRAS2) Exosome [BR:caty04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    105595718 (RRAS2)   Exosomal proteins of bladder cancer cells    105595718 (RRAS2) GTP-binding proteins [BR:caty04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105595718 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  105595718 NCBI-ProteinID:  XP_011937280 Ensembl:  ENSCATG00000043382 UniProt:  A0A2K5NVB3 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE QECPPSPEPTRKEKDKKGCHCVIF NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgggacggctccggccaggagaagtaccggctcgtggtggtc ggcgggggtggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgta acagattatgatccaaccattgaagattcttacacaaagcagtgtgtgatagatgacaga gcagcccggctagatattttggatacagcaggacaagaagagtttggagccatgagagaa cagtatatgaggactggcgagggcttcctgttggtcttttcagtcacagatagaggcagt tttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttc ccaatgattttaattggtaataaagcagatctggatcatcaaagacaggtaacacaggaa gaaggacagcagttagcacggcaacttaaggtaacatacatggaggcatcagcaaaaatt aggatgaatgtagatcaagctttccatgaacttgtccgggttatcaggaaatttcaagag caggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaaggctgccat tgtgtcattttctag

DBGET integrated database retrieval system