Cercocebus atys (sooty mangabey): 105595973 Help Entry 105595973         CDS       T07242                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty01522   Endocrine resistance caty04010   MAPK signaling pathway caty04012   ErbB signaling pathway caty04024   cAMP signaling pathway caty04137   Mitophagy - animal caty04210   Apoptosis caty04310   Wnt signaling pathway caty04380   Osteoclast differentiation caty04510   Focal adhesion caty04530   Tight junction caty04620   Toll-like receptor signaling pathway caty04621   NOD-like receptor signaling pathway caty04625   C-type lectin receptor signaling pathway caty04657   IL-17 signaling pathway caty04658   Th1 and Th2 cell differentiation caty04659   Th17 cell differentiation caty04660   T cell receptor signaling pathway caty04662   B cell receptor signaling pathway caty04668   TNF signaling pathway caty04722   Neurotrophin signaling pathway caty04912   GnRH signaling pathway caty04915   Estrogen signaling pathway caty04921   Oxytocin signaling pathway caty04926   Relaxin signaling pathway caty04932   Non-alcoholic fatty liver disease caty04933   AGE-RAGE signaling pathway in diabetic complications caty05030   Cocaine addiction caty05031   Amphetamine addiction caty05132   Salmonella infection caty05133   Pertussis caty05135   Yersinia infection caty05140   Leishmaniasis caty05142   Chagas disease caty05161   Hepatitis B caty05162   Measles caty05166   Human T-cell leukemia virus 1 infection caty05167   Kaposi sarcoma-associated herpesvirus infection caty05169   Epstein-Barr virus infection caty05170   Human immunodeficiency virus 1 infection caty05171   Coronavirus disease - COVID-19 caty05200   Pathways in cancer caty05203   Viral carcinogenesis caty05207   Chemical carcinogenesis - receptor activation caty05208   Chemical carcinogenesis - reactive oxygen species caty05210   Colorectal cancer caty05211   Renal cell carcinoma caty05224   Breast cancer caty05231   Choline metabolism in cancer caty05235   PD-L1 expression and PD-1 checkpoint pathway in cancer caty05321   Inflammatory bowel disease caty05323   Rheumatoid arthritis caty05417   Lipid and atherosclerosis caty05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105595973 (JUN)    04012 ErbB signaling pathway     105595973 (JUN)    04310 Wnt signaling pathway     105595973 (JUN)    04668 TNF signaling pathway     105595973 (JUN)    04024 cAMP signaling pathway     105595973 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     105595973 (JUN)   09143 Cell growth and death    04210 Apoptosis     105595973 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105595973 (JUN)    04530 Tight junction     105595973 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105595973 (JUN)    04621 NOD-like receptor signaling pathway     105595973 (JUN)    04625 C-type lectin receptor signaling pathway     105595973 (JUN)    04660 T cell receptor signaling pathway     105595973 (JUN)    04658 Th1 and Th2 cell differentiation     105595973 (JUN)    04659 Th17 cell differentiation     105595973 (JUN)    04657 IL-17 signaling pathway     105595973 (JUN)    04662 B cell receptor signaling pathway     105595973 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     105595973 (JUN)    04915 Estrogen signaling pathway     105595973 (JUN)    04921 Oxytocin signaling pathway     105595973 (JUN)    04926 Relaxin signaling pathway     105595973 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     105595973 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     105595973 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105595973 (JUN)    05207 Chemical carcinogenesis - receptor activation     105595973 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     105595973 (JUN)    05203 Viral carcinogenesis     105595973 (JUN)    05231 Choline metabolism in cancer     105595973 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105595973 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     105595973 (JUN)    05211 Renal cell carcinoma     105595973 (JUN)    05224 Breast cancer     105595973 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105595973 (JUN)    05170 Human immunodeficiency virus 1 infection     105595973 (JUN)    05161 Hepatitis B     105595973 (JUN)    05171 Coronavirus disease - COVID-19     105595973 (JUN)    05162 Measles     105595973 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     105595973 (JUN)    05169 Epstein-Barr virus infection     105595973 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     105595973 (JUN)    05135 Yersinia infection     105595973 (JUN)    05133 Pertussis     105595973 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105595973 (JUN)    05142 Chagas disease     105595973 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     105595973 (JUN)    05321 Inflammatory bowel disease     105595973 (JUN)   09165 Substance dependence    05030 Cocaine addiction     105595973 (JUN)    05031 Amphetamine addiction     105595973 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105595973 (JUN)    05418 Fluid shear stress and atherosclerosis     105595973 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105595973 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     105595973 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105595973 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:caty03000]     105595973 (JUN) Transcription factors [BR:caty03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     105595973 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  105595973 NCBI-ProteinID:  XP_011937852 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLPSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQPPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctatgatgatgccctcaacgcctcgttcctcccg tccgagagcggagcttatggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactctgacctc ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcagcggcgcagccggtcagcggggcg ggcatggtagctccagcggtagcctcggtggcagggggcagcggcagcggaggcttcagc gccagcctgcacagcgagccgcccgtctacgccaacctcagcaacttcaacccaggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa ccccagcagcagcagccgccgccgcagccgccacaccacctgccccagcagatgcccgtg cagcacccgcggctgcaagccctgaaggaggagcctcagacagtgcccgagatgcctggc gagacgccgcccctgtcccccattgacatggagtcccaggagcggatcaaggcggagagg aagcgtatgaggaaccgcattgctgcctccaagtgccgaaaaaggaagctggagagaatc gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system