Cercocebus atys (sooty mangabey): 105596231 Help Entry 105596231         CDS       T07242                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04060   Cytokine-cytokine receptor interaction caty04061   Viral protein interaction with cytokine and cytokine receptor caty04062   Chemokine signaling pathway caty04064   NF-kappa B signaling pathway caty04072   Phospholipase D signaling pathway caty04218   Cellular senescence caty04620   Toll-like receptor signaling pathway caty04621   NOD-like receptor signaling pathway caty04622   RIG-I-like receptor signaling pathway caty04657   IL-17 signaling pathway caty04932   Non-alcoholic fatty liver disease caty04933   AGE-RAGE signaling pathway in diabetic complications caty04936   Alcoholic liver disease caty05132   Salmonella infection caty05133   Pertussis caty05134   Legionellosis caty05135   Yersinia infection caty05142   Chagas disease caty05144   Malaria caty05146   Amoebiasis caty05161   Hepatitis B caty05163   Human cytomegalovirus infection caty05164   Influenza A caty05167   Kaposi sarcoma-associated herpesvirus infection caty05171   Coronavirus disease - COVID-19 caty05200   Pathways in cancer caty05202   Transcriptional misregulation in cancer caty05219   Bladder cancer caty05323   Rheumatoid arthritis caty05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105596231 (CXCL8)    04072 Phospholipase D signaling pathway     105596231 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105596231 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     105596231 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     105596231 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105596231 (CXCL8)    04621 NOD-like receptor signaling pathway     105596231 (CXCL8)    04622 RIG-I-like receptor signaling pathway     105596231 (CXCL8)    04657 IL-17 signaling pathway     105596231 (CXCL8)    04062 Chemokine signaling pathway     105596231 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105596231 (CXCL8)    05202 Transcriptional misregulation in cancer     105596231 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     105596231 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     105596231 (CXCL8)    05171 Coronavirus disease - COVID-19     105596231 (CXCL8)    05164 Influenza A     105596231 (CXCL8)    05163 Human cytomegalovirus infection     105596231 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     105596231 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     105596231 (CXCL8)    05135 Yersinia infection     105596231 (CXCL8)    05133 Pertussis     105596231 (CXCL8)    05134 Legionellosis     105596231 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     105596231 (CXCL8)    05144 Malaria     105596231 (CXCL8)    05142 Chagas disease     105596231 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     105596231 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105596231 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105596231 (CXCL8)    04932 Non-alcoholic fatty liver disease     105596231 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     105596231 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105596231 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:caty00536]     105596231 (CXCL8) Cytokines and neuropeptides [BR:caty04052]  Cytokines   Chemokines    105596231 (CXCL8) Glycosaminoglycan binding proteins [BR:caty00536]  Heparan sulfate / Heparin   Chemokines    105596231 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  105596231 NCBI-ProteinID:  XP_011938381 Ensembl:  ENSCATG00000044770 UniProt:  P46653 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MTSKLAVALLAAFLLSAALCEGAVLPRSAKELRCLCIKTYSKPFHPKFIKELRVIESGPH CVNTEIIVKLSDGRELCLDPKEPWVQRVVEKFLKRAESQNS NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggcggtggctctcttggcagccttcctgctttctgcagctctgtgt gaaggtgcagttttgccaaggagtgctaaagaacttagatgtctgtgcataaagacgtac tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac tgtgtcaatacagaaattattgtaaaactttccgatggaagagagctctgtctggacccc aaggaaccatgggtgcagagggttgtggagaagtttttgaagagggctgagagtcaaaat tcataa

DBGET integrated database retrieval system