Cercocebus atys (sooty mangabey): 105596344 Help Entry 105596344         CDS       T07242                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism caty  Cercocebus atys (sooty mangabey) Pathway caty01521   EGFR tyrosine kinase inhibitor resistance caty01522   Endocrine resistance caty04010   MAPK signaling pathway caty04012   ErbB signaling pathway caty04014   Ras signaling pathway caty04015   Rap1 signaling pathway caty04062   Chemokine signaling pathway caty04068   FoxO signaling pathway caty04071   Sphingolipid signaling pathway caty04072   Phospholipase D signaling pathway caty04137   Mitophagy - animal caty04140   Autophagy - animal caty04150   mTOR signaling pathway caty04151   PI3K-Akt signaling pathway caty04210   Apoptosis caty04211   Longevity regulating pathway caty04213   Longevity regulating pathway - multiple species caty04218   Cellular senescence caty04360   Axon guidance caty04370   VEGF signaling pathway caty04371   Apelin signaling pathway caty04540   Gap junction caty04550   Signaling pathways regulating pluripotency of stem cells caty04625   C-type lectin receptor signaling pathway caty04650   Natural killer cell mediated cytotoxicity caty04660   T cell receptor signaling pathway caty04662   B cell receptor signaling pathway caty04664   Fc epsilon RI signaling pathway caty04714   Thermogenesis caty04720   Long-term potentiation caty04722   Neurotrophin signaling pathway caty04725   Cholinergic synapse caty04726   Serotonergic synapse caty04730   Long-term depression caty04810   Regulation of actin cytoskeleton caty04910   Insulin signaling pathway caty04912   GnRH signaling pathway caty04915   Estrogen signaling pathway caty04916   Melanogenesis caty04917   Prolactin signaling pathway caty04919   Thyroid hormone signaling pathway caty04921   Oxytocin signaling pathway caty04926   Relaxin signaling pathway caty04929   GnRH secretion caty04933   AGE-RAGE signaling pathway in diabetic complications caty04935   Growth hormone synthesis, secretion and action caty05010   Alzheimer disease caty05022   Pathways of neurodegeneration - multiple diseases caty05034   Alcoholism caty05160   Hepatitis C caty05161   Hepatitis B caty05163   Human cytomegalovirus infection caty05165   Human papillomavirus infection caty05166   Human T-cell leukemia virus 1 infection caty05167   Kaposi sarcoma-associated herpesvirus infection caty05170   Human immunodeficiency virus 1 infection caty05200   Pathways in cancer caty05203   Viral carcinogenesis caty05205   Proteoglycans in cancer caty05206   MicroRNAs in cancer caty05207   Chemical carcinogenesis - receptor activation caty05208   Chemical carcinogenesis - reactive oxygen species caty05210   Colorectal cancer caty05211   Renal cell carcinoma caty05213   Endometrial cancer caty05214   Glioma caty05215   Prostate cancer caty05216   Thyroid cancer caty05218   Melanoma caty05219   Bladder cancer caty05220   Chronic myeloid leukemia caty05221   Acute myeloid leukemia caty05223   Non-small cell lung cancer caty05224   Breast cancer caty05225   Hepatocellular carcinoma caty05226   Gastric cancer caty05230   Central carbon metabolism in cancer caty05231   Choline metabolism in cancer caty05235   PD-L1 expression and PD-1 checkpoint pathway in cancer caty05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105596344 (NRAS)    04012 ErbB signaling pathway     105596344 (NRAS)    04014 Ras signaling pathway     105596344 (NRAS)    04015 Rap1 signaling pathway     105596344 (NRAS)    04370 VEGF signaling pathway     105596344 (NRAS)    04371 Apelin signaling pathway     105596344 (NRAS)    04068 FoxO signaling pathway     105596344 (NRAS)    04072 Phospholipase D signaling pathway     105596344 (NRAS)    04071 Sphingolipid signaling pathway     105596344 (NRAS)    04151 PI3K-Akt signaling pathway     105596344 (NRAS)    04150 mTOR signaling pathway     105596344 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105596344 (NRAS)    04137 Mitophagy - animal     105596344 (NRAS)   09143 Cell growth and death    04210 Apoptosis     105596344 (NRAS)    04218 Cellular senescence     105596344 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     105596344 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     105596344 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105596344 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105596344 (NRAS)    04650 Natural killer cell mediated cytotoxicity     105596344 (NRAS)    04660 T cell receptor signaling pathway     105596344 (NRAS)    04662 B cell receptor signaling pathway     105596344 (NRAS)    04664 Fc epsilon RI signaling pathway     105596344 (NRAS)    04062 Chemokine signaling pathway     105596344 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     105596344 (NRAS)    04929 GnRH secretion     105596344 (NRAS)    04912 GnRH signaling pathway     105596344 (NRAS)    04915 Estrogen signaling pathway     105596344 (NRAS)    04917 Prolactin signaling pathway     105596344 (NRAS)    04921 Oxytocin signaling pathway     105596344 (NRAS)    04926 Relaxin signaling pathway     105596344 (NRAS)    04935 Growth hormone synthesis, secretion and action     105596344 (NRAS)    04919 Thyroid hormone signaling pathway     105596344 (NRAS)    04916 Melanogenesis     105596344 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     105596344 (NRAS)    04726 Serotonergic synapse     105596344 (NRAS)    04720 Long-term potentiation     105596344 (NRAS)    04730 Long-term depression     105596344 (NRAS)    04722 Neurotrophin signaling pathway     105596344 (NRAS)   09158 Development and regeneration    04360 Axon guidance     105596344 (NRAS)   09149 Aging    04211 Longevity regulating pathway     105596344 (NRAS)    04213 Longevity regulating pathway - multiple species     105596344 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     105596344 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105596344 (NRAS)    05206 MicroRNAs in cancer     105596344 (NRAS)    05205 Proteoglycans in cancer     105596344 (NRAS)    05207 Chemical carcinogenesis - receptor activation     105596344 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     105596344 (NRAS)    05203 Viral carcinogenesis     105596344 (NRAS)    05230 Central carbon metabolism in cancer     105596344 (NRAS)    05231 Choline metabolism in cancer     105596344 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105596344 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     105596344 (NRAS)    05225 Hepatocellular carcinoma     105596344 (NRAS)    05226 Gastric cancer     105596344 (NRAS)    05214 Glioma     105596344 (NRAS)    05216 Thyroid cancer     105596344 (NRAS)    05221 Acute myeloid leukemia     105596344 (NRAS)    05220 Chronic myeloid leukemia     105596344 (NRAS)    05218 Melanoma     105596344 (NRAS)    05211 Renal cell carcinoma     105596344 (NRAS)    05219 Bladder cancer     105596344 (NRAS)    05215 Prostate cancer     105596344 (NRAS)    05213 Endometrial cancer     105596344 (NRAS)    05224 Breast cancer     105596344 (NRAS)    05223 Non-small cell lung cancer     105596344 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105596344 (NRAS)    05170 Human immunodeficiency virus 1 infection     105596344 (NRAS)    05161 Hepatitis B     105596344 (NRAS)    05160 Hepatitis C     105596344 (NRAS)    05163 Human cytomegalovirus infection     105596344 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     105596344 (NRAS)    05165 Human papillomavirus infection     105596344 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     105596344 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     105596344 (NRAS)   09165 Substance dependence    05034 Alcoholism     105596344 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105596344 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     105596344 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105596344 (NRAS)    01522 Endocrine resistance     105596344 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caty04131]     105596344 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caty04147]     105596344 (NRAS)    04031 GTP-binding proteins [BR:caty04031]     105596344 (NRAS) Membrane trafficking [BR:caty04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     105596344 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     105596344 (NRAS) Exosome [BR:caty04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105596344 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    105596344 (NRAS)   Exosomal proteins of breast cancer cells    105596344 (NRAS)   Exosomal proteins of colorectal cancer cells    105596344 (NRAS) GTP-binding proteins [BR:caty04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105596344 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase FeoB_N Motif Other DBs NCBI-GeneID:  105596344 NCBI-ProteinID:  XP_011938658 Ensembl:  ENSCATG00000040984 LinkDB All DBs Position Unknown AA seq 251 aa AA seqDB search MEANKVLLIFETLAPSAFIIETSRVGGAGLGAACRMTPGSEAHVAGAGTQSPGAPTDYVA GGAGSAAPWWGLFMAVPGSPTIFPAVVLNLSKAEAVELEDSYRKQVVIDGETCLLDILDT AGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKC DLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGT QGCMGLPCVVM NT seq 756 nt NT seq  +upstreamnt  +downstreamnt atggaagcgaataaagttttactgatttttgagacactagcacctagcgctttcattatt gaaacgtcccgtgtgggaggggcgggtctgggtgcggcctgccgcatgactcctggttca gaggcccacgtggccggggcggggacacagtcgcctggggcgccgactgattacgtagcg ggcggggccggaagtgccgctccctggtgggggctgttcatggcggttccggggtctcca acaattttccctgctgtggtcctgaatctgtccaaagcagaggcagtggagcttgaggat tcttacagaaaacaggtggttatagatggtgaaacctgtttgttggacatactggataca gctggacaagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttc ctctgtgtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggag cagattaagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgt gatttgccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacggg attccattcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacaca ctggtaagagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggact cagggttgtatgggattaccatgtgtggtgatgtaa

DBGET integrated database retrieval system