Cercocebus atys (sooty mangabey): 105598269 Help Entry 105598269         CDS       T07242                                  Name (RefSeq) histone H3.3C-like   KO K11253   histone H3 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04613   Neutrophil extracellular trap formation caty05034   Alcoholism caty05202   Transcriptional misregulation in cancer caty05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:caty00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105598269  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105598269   09163 Immune disease    05322 Systemic lupus erythematosus     105598269   09165 Substance dependence    05034 Alcoholism     105598269  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:caty03036]     105598269   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caty04147]     105598269 Chromosome and associated proteins [BR:caty03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105598269 Exosome [BR:caty04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105598269 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  105598269 NCBI-ProteinID:  XP_011942769 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MAGTKQTARKSTSGKAPRKQLSTKATCKSAPSTGGVKKPHRYRPGTVALGEISRYQKSTE FLIPKIPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARCIRGESA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctggtacaaagcagactgcccgcaaatcgaccagcggtaaggcacccaggaagcaa ctgtctacaaaagccacttgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcgctcggtgaaattagccgttatcagaagtccactgaa tttctgattcccaaaattcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgctttcagagcgcagctatcggtgctttgcaggaggcgagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgctgcatacgtggagaaagtgcttaa

DBGET integrated database retrieval system