KEGG   Cercocebus atys (sooty mangabey): 105598850
Entry
105598850         CDS       T07242                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
caty  Cercocebus atys (sooty mangabey)
Pathway
caty01521  EGFR tyrosine kinase inhibitor resistance
caty01522  Endocrine resistance
caty01524  Platinum drug resistance
caty04010  MAPK signaling pathway
caty04012  ErbB signaling pathway
caty04014  Ras signaling pathway
caty04015  Rap1 signaling pathway
caty04022  cGMP-PKG signaling pathway
caty04024  cAMP signaling pathway
caty04062  Chemokine signaling pathway
caty04066  HIF-1 signaling pathway
caty04068  FoxO signaling pathway
caty04071  Sphingolipid signaling pathway
caty04072  Phospholipase D signaling pathway
caty04114  Oocyte meiosis
caty04140  Autophagy - animal
caty04148  Efferocytosis
caty04150  mTOR signaling pathway
caty04151  PI3K-Akt signaling pathway
caty04210  Apoptosis
caty04218  Cellular senescence
caty04261  Adrenergic signaling in cardiomyocytes
caty04270  Vascular smooth muscle contraction
caty04350  TGF-beta signaling pathway
caty04360  Axon guidance
caty04370  VEGF signaling pathway
caty04371  Apelin signaling pathway
caty04380  Osteoclast differentiation
caty04510  Focal adhesion
caty04517  IgSF CAM signaling
caty04520  Adherens junction
caty04540  Gap junction
caty04550  Signaling pathways regulating pluripotency of stem cells
caty04611  Platelet activation
caty04613  Neutrophil extracellular trap formation
caty04620  Toll-like receptor signaling pathway
caty04621  NOD-like receptor signaling pathway
caty04625  C-type lectin receptor signaling pathway
caty04650  Natural killer cell mediated cytotoxicity
caty04657  IL-17 signaling pathway
caty04658  Th1 and Th2 cell differentiation
caty04659  Th17 cell differentiation
caty04660  T cell receptor signaling pathway
caty04662  B cell receptor signaling pathway
caty04664  Fc epsilon RI signaling pathway
caty04666  Fc gamma R-mediated phagocytosis
caty04668  TNF signaling pathway
caty04713  Circadian entrainment
caty04720  Long-term potentiation
caty04722  Neurotrophin signaling pathway
caty04723  Retrograde endocannabinoid signaling
caty04724  Glutamatergic synapse
caty04725  Cholinergic synapse
caty04726  Serotonergic synapse
caty04730  Long-term depression
caty04810  Regulation of actin cytoskeleton
caty04910  Insulin signaling pathway
caty04912  GnRH signaling pathway
caty04914  Progesterone-mediated oocyte maturation
caty04915  Estrogen signaling pathway
caty04916  Melanogenesis
caty04917  Prolactin signaling pathway
caty04919  Thyroid hormone signaling pathway
caty04921  Oxytocin signaling pathway
caty04926  Relaxin signaling pathway
caty04928  Parathyroid hormone synthesis, secretion and action
caty04929  GnRH secretion
caty04930  Type II diabetes mellitus
caty04933  AGE-RAGE signaling pathway in diabetic complications
caty04934  Cushing syndrome
caty04935  Growth hormone synthesis, secretion and action
caty04960  Aldosterone-regulated sodium reabsorption
caty05010  Alzheimer disease
caty05020  Prion disease
caty05022  Pathways of neurodegeneration - multiple diseases
caty05034  Alcoholism
caty05132  Salmonella infection
caty05133  Pertussis
caty05135  Yersinia infection
caty05140  Leishmaniasis
caty05142  Chagas disease
caty05145  Toxoplasmosis
caty05152  Tuberculosis
caty05160  Hepatitis C
caty05161  Hepatitis B
caty05163  Human cytomegalovirus infection
caty05164  Influenza A
caty05165  Human papillomavirus infection
caty05166  Human T-cell leukemia virus 1 infection
caty05167  Kaposi sarcoma-associated herpesvirus infection
caty05170  Human immunodeficiency virus 1 infection
caty05171  Coronavirus disease - COVID-19
caty05200  Pathways in cancer
caty05203  Viral carcinogenesis
caty05205  Proteoglycans in cancer
caty05206  MicroRNAs in cancer
caty05207  Chemical carcinogenesis - receptor activation
caty05208  Chemical carcinogenesis - reactive oxygen species
caty05210  Colorectal cancer
caty05211  Renal cell carcinoma
caty05212  Pancreatic cancer
caty05213  Endometrial cancer
caty05214  Glioma
caty05215  Prostate cancer
caty05216  Thyroid cancer
caty05218  Melanoma
caty05219  Bladder cancer
caty05220  Chronic myeloid leukemia
caty05221  Acute myeloid leukemia
caty05223  Non-small cell lung cancer
caty05224  Breast cancer
caty05225  Hepatocellular carcinoma
caty05226  Gastric cancer
caty05230  Central carbon metabolism in cancer
caty05231  Choline metabolism in cancer
caty05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
caty05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:caty00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105598850 (MAPK3)
   04012 ErbB signaling pathway
    105598850 (MAPK3)
   04014 Ras signaling pathway
    105598850 (MAPK3)
   04015 Rap1 signaling pathway
    105598850 (MAPK3)
   04350 TGF-beta signaling pathway
    105598850 (MAPK3)
   04370 VEGF signaling pathway
    105598850 (MAPK3)
   04371 Apelin signaling pathway
    105598850 (MAPK3)
   04668 TNF signaling pathway
    105598850 (MAPK3)
   04066 HIF-1 signaling pathway
    105598850 (MAPK3)
   04068 FoxO signaling pathway
    105598850 (MAPK3)
   04072 Phospholipase D signaling pathway
    105598850 (MAPK3)
   04071 Sphingolipid signaling pathway
    105598850 (MAPK3)
   04024 cAMP signaling pathway
    105598850 (MAPK3)
   04022 cGMP-PKG signaling pathway
    105598850 (MAPK3)
   04151 PI3K-Akt signaling pathway
    105598850 (MAPK3)
   04150 mTOR signaling pathway
    105598850 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    105598850 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105598850 (MAPK3)
   04148 Efferocytosis
    105598850 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    105598850 (MAPK3)
   04210 Apoptosis
    105598850 (MAPK3)
   04218 Cellular senescence
    105598850 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105598850 (MAPK3)
   04520 Adherens junction
    105598850 (MAPK3)
   04540 Gap junction
    105598850 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    105598850 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105598850 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105598850 (MAPK3)
   04613 Neutrophil extracellular trap formation
    105598850 (MAPK3)
   04620 Toll-like receptor signaling pathway
    105598850 (MAPK3)
   04621 NOD-like receptor signaling pathway
    105598850 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    105598850 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    105598850 (MAPK3)
   04660 T cell receptor signaling pathway
    105598850 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    105598850 (MAPK3)
   04659 Th17 cell differentiation
    105598850 (MAPK3)
   04657 IL-17 signaling pathway
    105598850 (MAPK3)
   04662 B cell receptor signaling pathway
    105598850 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    105598850 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    105598850 (MAPK3)
   04062 Chemokine signaling pathway
    105598850 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105598850 (MAPK3)
   04929 GnRH secretion
    105598850 (MAPK3)
   04912 GnRH signaling pathway
    105598850 (MAPK3)
   04915 Estrogen signaling pathway
    105598850 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    105598850 (MAPK3)
   04917 Prolactin signaling pathway
    105598850 (MAPK3)
   04921 Oxytocin signaling pathway
    105598850 (MAPK3)
   04926 Relaxin signaling pathway
    105598850 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    105598850 (MAPK3)
   04919 Thyroid hormone signaling pathway
    105598850 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    105598850 (MAPK3)
   04916 Melanogenesis
    105598850 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105598850 (MAPK3)
   04270 Vascular smooth muscle contraction
    105598850 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105598850 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    105598850 (MAPK3)
   04725 Cholinergic synapse
    105598850 (MAPK3)
   04726 Serotonergic synapse
    105598850 (MAPK3)
   04720 Long-term potentiation
    105598850 (MAPK3)
   04730 Long-term depression
    105598850 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    105598850 (MAPK3)
   04722 Neurotrophin signaling pathway
    105598850 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    105598850 (MAPK3)
   04380 Osteoclast differentiation
    105598850 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105598850 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105598850 (MAPK3)
   05206 MicroRNAs in cancer
    105598850 (MAPK3)
   05205 Proteoglycans in cancer
    105598850 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    105598850 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    105598850 (MAPK3)
   05203 Viral carcinogenesis
    105598850 (MAPK3)
   05230 Central carbon metabolism in cancer
    105598850 (MAPK3)
   05231 Choline metabolism in cancer
    105598850 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105598850 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105598850 (MAPK3)
   05212 Pancreatic cancer
    105598850 (MAPK3)
   05225 Hepatocellular carcinoma
    105598850 (MAPK3)
   05226 Gastric cancer
    105598850 (MAPK3)
   05214 Glioma
    105598850 (MAPK3)
   05216 Thyroid cancer
    105598850 (MAPK3)
   05221 Acute myeloid leukemia
    105598850 (MAPK3)
   05220 Chronic myeloid leukemia
    105598850 (MAPK3)
   05218 Melanoma
    105598850 (MAPK3)
   05211 Renal cell carcinoma
    105598850 (MAPK3)
   05219 Bladder cancer
    105598850 (MAPK3)
   05215 Prostate cancer
    105598850 (MAPK3)
   05213 Endometrial cancer
    105598850 (MAPK3)
   05224 Breast cancer
    105598850 (MAPK3)
   05223 Non-small cell lung cancer
    105598850 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105598850 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    105598850 (MAPK3)
   05161 Hepatitis B
    105598850 (MAPK3)
   05160 Hepatitis C
    105598850 (MAPK3)
   05171 Coronavirus disease - COVID-19
    105598850 (MAPK3)
   05164 Influenza A
    105598850 (MAPK3)
   05163 Human cytomegalovirus infection
    105598850 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105598850 (MAPK3)
   05165 Human papillomavirus infection
    105598850 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105598850 (MAPK3)
   05135 Yersinia infection
    105598850 (MAPK3)
   05133 Pertussis
    105598850 (MAPK3)
   05152 Tuberculosis
    105598850 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105598850 (MAPK3)
   05140 Leishmaniasis
    105598850 (MAPK3)
   05142 Chagas disease
    105598850 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105598850 (MAPK3)
   05020 Prion disease
    105598850 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    105598850 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    105598850 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105598850 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105598850 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105598850 (MAPK3)
   04934 Cushing syndrome
    105598850 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105598850 (MAPK3)
   01524 Platinum drug resistance
    105598850 (MAPK3)
   01522 Endocrine resistance
    105598850 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:caty01001]
    105598850 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:caty03036]
    105598850 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:caty04147]
    105598850 (MAPK3)
Enzymes [BR:caty01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105598850 (MAPK3)
Protein kinases [BR:caty01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105598850 (MAPK3)
Chromosome and associated proteins [BR:caty03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     105598850 (MAPK3)
Exosome [BR:caty04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105598850 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 105598850
NCBI-ProteinID: XP_011943959
Ensembl: ENSCATG00000029901
LinkDB
Position
Unknown
AA seq 379 aa
MAAAAAQGGGGGEPRRAEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggtggggagccccggagagccgagggggtc
ggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcggcctat
gaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgagcatcagacc
tactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaatgtc
atcggcatccgagacattctgcgtgcgtccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcaactgagcaat
gaccacatctgctacttcctctaccagatcctgcggggcctcaagtacatccactccgct
aatgtgctccaccgggatctaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatttgcgatttcggcctggcccggattgccgatcctgagcatgaccacaccggcttc
ctgacggagtatgtggctacacgctggtaccgggccccagagatcatgctgaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctct
aaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggcatc
ctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtcagac
tccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacggatcaca
gtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgagcca
gtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggagcggctg
aaggagcttatcttccaggagacagcacgcttccagcctggggcgctagaggccccctaa

DBGET integrated database retrieval system