Cercocebus atys (sooty mangabey): 105599745 Help Entry 105599745         CDS       T07242                                  Symbol IL13 Name (RefSeq) interleukin-13   KO K05435   interleukin 13 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04060   Cytokine-cytokine receptor interaction caty04630   JAK-STAT signaling pathway caty04657   IL-17 signaling pathway caty04658   Th1 and Th2 cell differentiation caty04664   Fc epsilon RI signaling pathway caty05200   Pathways in cancer caty05310   Asthma caty05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105599745 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105599745 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     105599745 (IL13)    04657 IL-17 signaling pathway     105599745 (IL13)    04664 Fc epsilon RI signaling pathway     105599745 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105599745 (IL13)   09163 Immune disease    05310 Asthma     105599745 (IL13)    05321 Inflammatory bowel disease     105599745 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105599745 (IL13) Cytokines and neuropeptides [BR:caty04052]  Cytokines   Interleukins    105599745 (IL13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  105599745 NCBI-ProteinID:  XP_011945601 Ensembl:  ENSCATG00000030939 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search MRPLLNPLLLALGLMALLLTMVIALTCLGGFASPSPVPPSTALKELIEELVNITQNQKAP LCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRD TKIEVAQFVKDLLLHLKKLFREGQFN NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgcgtccgctcctcaatcctctcctgttggcactgggcctcatggcgctcttgttgacc atggtcattgctctcacttgcctcggcggctttgcctccccaagccctgtgcctccctct acagccctcaaggagctcattgaggagctggtcaacatcacccagaaccagaaggccccg ctctgcaacggcagcatggtgtggagcatcaacctgacagctggcgtgtactgtgcagcc ctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg aacggattctgcccgcacaaggtctcagctgggcagttttccagcttgcgtgtccgagac accaaaatcgaggtggcccagtttgtaaaggatctgctcttacatttaaagaaacttttt cgcgagggacagttcaactga

DBGET integrated database retrieval system