Cercocebus atys (sooty mangabey): 105599937 Help Entry 105599937         CDS       T07242                                  Name (RefSeq) cofilin-2   KO K05765   cofilin Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04360   Axon guidance caty04666   Fc gamma R-mediated phagocytosis caty04810   Regulation of actin cytoskeleton caty05133   Pertussis caty05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:caty00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105599937  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     105599937   09158 Development and regeneration    04360 Axon guidance     105599937  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105599937   09171 Infectious disease: bacterial    05133 Pertussis     105599937  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caty04131]     105599937   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:caty04812]     105599937    04147 Exosome [BR:caty04147]     105599937 Membrane trafficking [BR:caty04131]  Others   Actin-binding proteins    Others     105599937 Cytoskeleton proteins [BR:caty04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      105599937 Exosome [BR:caty04147]  Exosomal proteins   Proteins found in most exosomes    105599937 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  105599937 NCBI-ProteinID:  XP_011945995 Ensembl:  ENSCATG00000030115 LinkDB All DBs Position Unknown AA seq 158 aa AA seqDB search MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVV NT seq 475 nt NT seq  +upstreamnt  +downstreamnt atggcttctggagttacagtgaatgatgaagtcataaaagtttttaatgatatgaaagta aggaaatcttctacacaagaggagatcaaaaagagaaagaaagcagttctcttctgttta agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta tttatattctgggctcctgaaagtgcacctttaaaaagcaagatgatttatgctagctct aaagatgccattaaaaagaaatttacaggtattaaacatgagtggcaagtaaatggcttg gatgatattaaggaccgttcgacacttggagagaaattgggaggcaatgtagtag

DBGET integrated database retrieval system