KEGG   Chloroflexus aurantiacus: Caur_1134
Entry
Caur_1134         CDS       T00639                                 
Name
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau03410  Base excision repair
cau03430  Mismatch repair
cau03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cau00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Caur_1134
   03430 Mismatch repair
    Caur_1134
   03440 Homologous recombination
    Caur_1134
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cau03400]
    Caur_1134
DNA repair and recombination proteins [BR:cau03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     Caur_1134
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Caur_1134
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Caur_1134
SSDB
Motif
Pfam: RecJ_OB DHH DHHA1
Other DBs
NCBI-ProteinID: ABY34364
UniProt: A9WJ87
LinkDB
Position
complement(1578966..1580678)
AA seq 570 aa
MSARRQRWEIRPPAPTSFVEQLGLHPLLAHLLYQRGLHEPSIARAFLNADYSSGLHDPFA
MRGMAAAAGRIAEAIERGELIAVYGDFDVDGITAVALLTQAIKAMGGRIRPYIPHRAREG
YGLNNLAISQLVADGVTLLITVDCGISNYAEVAEANRLGLDVIVTDHHHPPMLLPPALAI
VNPRQPDCAYPFKGLVGVGIAFKVVQALARYGKRPAGLRGRDLLDLVALGTVADMGPLHD
ENRVLVRAGLIALNESSRPGVLALVAAAGLSPGMIDSGAIAFALAPRLNAAGRLADARRA
YELLLADERMKADLLAAELNTTNRERQALTRQLYAMAETMVMQSGRTEHPLIVVSHPGFN
AGVIGLVAARLVETYHRPVIVIEQGEETSRGSARSIPGFSIIDLFDQCADLFVRYGGHAA
AAGFTISTNQITALEQRLLALGSQHLSAEQLVPRLLIDATVPLSDLSWDLYATLCQLEPF
GQGNPQPVFMTPNVTVIDPQPTTDGNHLRMRVRVGQTSFEAIGFHFGRFADALRRHPNID
LAYQLAVDEWNGQRRLRLLVRDFRRATKSE
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgtcagctcgccgtcagcgctgggagatccgtccgccagcacccacttctttcgttgag
caacttggtctgcacccgttgcttgcacaccttctttatcagcgtggcttgcatgagcca
tccatcgccagagcttttcttaacgctgattacagctccggcctgcacgatccgtttgcc
atgcgaggtatggcagccgctgccggtcgtattgccgaagcgattgagcggggcgaattg
atcgccgtctacggcgattttgatgtcgatgggatcactgcggttgccctgctgacgcag
gcgatcaaggcgatggggggacggattcggccatacattccgcatcgtgcccgcgaaggg
tatggtcttaacaatctggcgattagtcagttggtggccgatggtgtcacattgctgata
acggtcgactgcggcatttccaattatgcagaggtagccgaagccaatcggctcggcctc
gatgtgattgtcactgatcaccaccatccacccatgttgctgccgccagccctggcaata
gtgaatccacgccagcccgactgtgcctatccattcaaaggtctggttggggtcgggatt
gccttcaaagtcgtgcaggcactggcacgctacggtaagcggccagccggtttacgtgga
cgtgatctgctcgatctggttgcgctaggcactgtcgccgatatgggtccactccacgac
gagaatcgggtgttggtacgggccggcttgattgcgctcaatgaaagttcgcgtcctggt
gtcctggcattggtggcggctgccggcctgtcgccgggtatgatcgacagcggcgcaatt
gcgttcgctctggcaccgcgcctcaacgcagccggtcgcttagccgatgcgcgtcgtgcg
tatgagctgctcctggctgatgagcgaatgaaagccgatctgctggctgccgaattgaat
accaccaatcgtgagcggcaggcattgacccggcaattatatgccatggcagaaaccatg
gtgatgcagagtggtcgcaccgaacatccgctgattgtcgtctcgcaccccggttttaac
gcgggtgttatcggattggtcgccgcccgtttggttgagacctatcatcgtccggtaatt
gtgatcgagcaaggcgaggagacatcacgtggatcagcgcgctcgatccccgggtttagt
atcatcgatctgttcgatcaatgtgccgatctctttgtccgttatggtggacatgctgcg
gctgccggttttacgatttccacgaaccagattacggcgctcgaacagcggttactggcc
ctggggagccagcatctgtcagccgaacagctcgtaccacgattgttgatcgatgccact
gtgccattaagtgatttatcgtgggatctatacgctaccctgtgccagctcgaaccgttt
ggacagggtaatccgcagcctgtgttcatgacccccaatgttacagtcatcgatccgcaa
ccgacaactgatggcaatcatctgcggatgcgtgtgcgtgtcggtcagacctcgttcgag
gctatcggttttcactttggtcgcttcgcggatgcgcttcgtcgtcatccaaacatcgat
ctggcgtaccagttggcagttgatgaatggaacggacagcgtcgcttacggctgctggtg
cgcgatttccggcgcgcaacgaagagcgagtga

DBGET integrated database retrieval system