Chloroflexus aurantiacus: Caur_1822 Help Entry Caur_1822         CDS       T00639                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism cau  Chloroflexus aurantiacus Brite KEGG Orthology (KO) [BR:cau00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Caur_1822 Enzymes [BR:cau01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Caur_1822 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_2 GST_N_2 Thioredoxin_9 TXD17-like_Trx Glrx-like DUF3088 Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  ABY35039 UniProt:  A9WD72 LinkDB All DBs Position 2505705..2505956 Genome browser AA seq 83 aa AA seqDB search MTTQSIVVYGTNWCPDCRRAQRVLDQHGVPYTYINIEHDPAAAEFVIKVNNGNQSVPTIV FPDGSILVEPSNHLLQTKLNQLG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccacgcaatccattgttgtctacggtaccaactggtgccctgattgccgtcgtgcc cagcgcgtgcttgatcagcacggcgtaccgtacacctacatcaatattgaacacgatccg gctgcggctgaatttgtgatcaaggtcaataatggcaatcagagtgtgccaaccattgtt tttcccgatggttcaattctggttgagccgtcaaaccatctcttacaaacgaagttgaac caattgggatag

DBGET integrated database retrieval system