Carassius auratus (goldfish): 113043014 Help Entry 113043014         CDS       T07313                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism caua  Carassius auratus (goldfish) Pathway caua04020   Calcium signaling pathway caua04070   Phosphatidylinositol signaling system caua04114   Oocyte meiosis caua04218   Cellular senescence caua04261   Adrenergic signaling in cardiomyocytes caua04270   Vascular smooth muscle contraction caua04371   Apelin signaling pathway caua04625   C-type lectin receptor signaling pathway caua04744   Phototransduction caua04910   Insulin signaling pathway caua04912   GnRH signaling pathway caua04916   Melanogenesis Brite KEGG Orthology (KO) [BR:caua00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     113043014    04020 Calcium signaling pathway     113043014    04070 Phosphatidylinositol signaling system     113043014  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     113043014    04218 Cellular senescence     113043014  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113043014   09152 Endocrine system    04910 Insulin signaling pathway     113043014    04912 GnRH signaling pathway     113043014    04916 Melanogenesis     113043014   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     113043014    04270 Vascular smooth muscle contraction     113043014   09157 Sensory system    04744 Phototransduction     113043014  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:caua01009]     113043014   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caua04131]     113043014    03036 Chromosome and associated proteins [BR:caua03036]     113043014   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113043014 Protein phosphatases and associated proteins [BR:caua01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      113043014 Membrane trafficking [BR:caua04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     113043014 Chromosome and associated proteins [BR:caua03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      113043014 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113043014 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 CFAP251_C EF-hand_8 SAPC2_N EF_EFCAB10_C AIF-1 EFhand_Ca_insen EH Motif Other DBs NCBI-GeneID:  113043014 NCBI-ProteinID:  XP_026057891 UniProt:  A0A6P6JCP8 LinkDB All DBs Position 25:complement(3561890..3566356) Genome browser AA seq 151 aa AA seqDB search MAKFLSQDQINEYKECFSLYDQKRRGKVKAQDLLTVMRSLGCCPTLQELDRHLLTHNIDK SGELDFSTFLSVMHAQIQQEKPRDEILRAVRFMDTSKRGFITASELRARLTGFGEPLTDQ EVDELLSEAVVTDDGQINDEGFEKMVTFLTS NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggcgaaattcctcagtcaagatcaaatcaacgagtataaggagtgtttttcgctgtat gaccagaagcgcaggggtaaagtgaaggcacaggatctgctgacggtcatgagatctctg ggctgctgtccgaccctgcaagagctcgacagacacttgctgacccataacatcgataag agcggcgagttggacttctccacgtttctcagcgtgatgcatgcacagatccagcaggag aagccacgggacgagatcctgcgagccgtgaggttcatggacacgagcaaacgaggcttt atcacagcgtcagagctcagggccagactgacaggcttcggagagccactcacggatcag gaagtggacgagctgctgagtgaagccgtcgtgaccgatgacggccaaattaacgacgag ggttttgagaaaatggtgacatttctgaccagctga

DBGET integrated database retrieval system