Carassius auratus (goldfish): 113051762 Help Entry 113051762         CDS       T07313                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism caua  Carassius auratus (goldfish) Pathway caua03082   ATP-dependent chromatin remodeling caua04217   Necroptosis Brite KEGG Orthology (KO) [BR:caua00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     113051762  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     113051762  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:caua03036]     113051762   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113051762 Chromosome and associated proteins [BR:caua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113051762 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113051762 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  113051762 NCBI-ProteinID:  XP_026071598 UniProt:  A0A6P6KH17 LinkDB All DBs Position 32:19157212..19157821 Genome browser AA seq 84 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHL NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcggaagaggcaaaaccggcggcaaagcgagagcgaaggccaagactcgctcctcc agagcagggctgcagttccccgtcggtcgtgttcacagacttcttcgtaaaggaaactac gccgagcgcgtcggtgccggagctcccgtctatctggcggctgtgctcgagtatctgacc gctgagatcctggagttggctggaaacgccgcgagagacaacaagaagacccgcatcatt ccccgtcacctgtag

DBGET integrated database retrieval system