Carassius auratus (goldfish): 113056286 Help Entry 113056286         CDS       T07313                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism caua  Carassius auratus (goldfish) Pathway caua04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:caua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113056286  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:caua04121]     113056286    03400 DNA repair and recombination proteins [BR:caua03400]     113056286 Ubiquitin system [BR:caua04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113056286    Cul5 complex      113056286 DNA repair and recombination proteins [BR:caua03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113056286 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  113056286 NCBI-ProteinID:  XP_026078713 Ensembl:  ENSCARG00000006412 UniProt:  A0A6P6L2B5 LinkDB All DBs Position 37:13549394..13555448 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRHRKTTIFTDAKESTTVYELKCIVEGILKRSAEEQRLYKDEQPLEDSKTLGDC GFTNQTARPQAPATVGLAFRISDDAFEPLQVEPFSNPPELPDVMKPQDCGSTANEQSVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcttaatgatcaggcatcgcaaaaccacaatcttcacagacgccaaagaa tcaacaactgtctatgagttaaaatgcattgtggagggcattctgaagcggtccgctgag gaacagagactatacaaggatgagcagcctctagaagacagtaagacacttggagactgc ggcttcacaaatcagacagccagaccacaggctcctgcgactgtaggactggcctttcgt atcagtgatgatgcatttgagcccctgcaggtggaaccattttccaaccctcctgaactt cctgatgttatgaaaccacaggactgtggcagtacagccaatgaacagtcagtgcaatga

DBGET integrated database retrieval system