Carassius auratus (goldfish): 113059208 Help Entry 113059208         CDS       T07313                                  Name (RefSeq) syntaxin-12-like isoform X1   KO K08488   syntaxin 7 Organism caua  Carassius auratus (goldfish) Pathway caua04130   SNARE interactions in vesicular transport caua04140   Autophagy - animal caua04145   Phagosome Brite KEGG Orthology (KO) [BR:caua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04130 SNARE interactions in vesicular transport     113059208  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     113059208    04140 Autophagy - animal     113059208  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caua04131]     113059208   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113059208 Membrane trafficking [BR:caua04131]  SNARE   Syntaxin (Qa)    Stx-Endo     113059208 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113059208 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SNARE Motif Other DBs NCBI-GeneID:  113059208 NCBI-ProteinID:  XP_026083326 UniProt:  A0A6P6LIR3 LinkDB All DBs Position 41:19851324..19882329 Genome browser AA seq 100 aa AA seqDB search MLDVNQIMKDLASMVHEQGDTIDSVEDYIQTTSSHVESANHELAKASHYQKFLFPVISPQ LPSKMSLHVEVHLRSLPLFLSLSVLLSDYVYASMEMCVCV NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgctggacgtcaatcagattatgaaagacttggccagcatggtgcatgaacaaggagac accatagacagcgttgaagattacattcagaccacctcatcgcatgtggaatcagccaat cacgagcttgcaaaagctagtcattatcagaaattcctgtttcctgtgatctctcctcaa cttcccagcaaaatgagtctacatgtagaggttcacctgcgctcacttcctctcttctta tctctgtctgtacttctgtcggattatgtgtacgcaagtatggaaatgtgtgtgtgtgtg tga

DBGET integrated database retrieval system