Carassius auratus (goldfish): 113062225 Help Entry 113062225         CDS       T07313                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism caua  Carassius auratus (goldfish) Pathway caua04382   Cornified envelope formation caua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caua00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     113062225  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113062225  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113062225 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of microglial cells    113062225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  113062225 NCBI-ProteinID:  XP_026087715 Ensembl:  ENSCARG00000020334 UniProt:  A0A6P6LW64 LinkDB All DBs Position 44:5054062..5055100 Genome browser AA seq 101 aa AA seqDB search MPSELETAMESLIMVFHRYAGKEGKSGSLTRRELRTLMENELSGFLKSQKDPTTIDRIMK DLDANGDGEVNFEEFVSLVVGLSIACEACYRMQLKKTQSWK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccatccgagctagagaccgccatggagtccctcatcatggtattccaccgctacgct ggaaaagagggcaagagtggctccctgacccgccgtgaactccgaaccctgatggagaac gagctctctgggtttctcaagtctcaaaaggatccgactactatcgacagaattatgaag gacttggatgccaatggagatggggaggtgaactttgaggagtttgtgtctttggttgtg ggtttgtccatcgcctgtgaagcgtgctacaggatgcagttaaagaagacacaaagctgg aaatga

DBGET integrated database retrieval system