Carassius auratus (goldfish): 113063947 Help Entry 113063947         CDS       T07313                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism caua  Carassius auratus (goldfish) Pathway caua03272   Virion - Hepatitis viruses caua04382   Cornified envelope formation caua04514   Cell adhesion molecules caua04530   Tight junction Brite KEGG Orthology (KO) [BR:caua00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     113063947  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     113063947  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     113063947  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     113063947  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:caua03037]     113063947    04147 Exosome [BR:caua04147]     113063947    04515 Cell adhesion molecules [BR:caua04515]     113063947 Cilium and associated proteins [BR:caua03037]  Other cilia and associated proteins   Stereociliary proteins    113063947 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    113063947   Exosomal proteins of colorectal cancer cells    113063947 Cell adhesion molecules [BR:caua04515]  Immunoglobulin superfamily   L1 family    113063947 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Motif Other DBs NCBI-GeneID:  113063947 NCBI-ProteinID:  XP_026090203 UniProt:  A0A6P6M0G5 LinkDB All DBs Position 46:complement(5559848..5561310) Genome browser AA seq 145 aa AA seqDB search MVSAGLQILGICQATLGFLGSSIVCGLPKWKVTAFIGSNIVTKQNFWEGLWMNCVVQSTG QMQCKVYDILLALPQDLQGTQALVIIAIIADIATRMTFFLMTDIVRGQGSYNCLSRSILQ NIFYYVAQRNIISESSFIIIYTIFK NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atggtgtctgcgggacttcagatcttgggcatctgccaggctacactcggcttcttggga agcagcattgtctgtggcttgcccaaatggaaggtgacggcattcattggatccaacatt gtgaccaagcagaacttttgggaaggtttatggatgaactgtgtggttcagagcacagga cagatgcagtgtaaagtgtacgacattctgctggctcttcctcaagatctgcagggcacc caagccttggtgatcatcgccattatcgctgacattgcaacacgtatgacgttctttctt atgactgatattgtgagaggtcaaggaagttataactgtttatctaggagcattcttcaa aatatcttctattatgttgcacagaggaacatcatttcagaatcttcatttattataatt tataccatattcaaatga

DBGET integrated database retrieval system