Carassius auratus (goldfish): 113065415 Help Entry 113065415         CDS       T07313                                  Name (RefSeq) histone H2B.1, sperm-like   KO K11252   histone H2B Organism caua  Carassius auratus (goldfish) Brite KEGG Orthology (KO) [BR:caua00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:caua03036]     113065415   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113065415 Chromosome and associated proteins [BR:caua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113065415 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113065415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  113065415 NCBI-ProteinID:  XP_026092420 UniProt:  A0A6P6M6U2 LinkDB All DBs Position 48:complement(641948..642434) Genome browser AA seq 93 aa AA seqDB search MKTSSDRNRKSLKKSRSTCRTHKQSTHAYSAYIYKIKKELSVLVSDASLMRHLSGAQAQV CAEAARLSKFNRRHVITQRELSAAARALRHRSS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaaacctcatctgacaggaaccggaagtccctaaagaagtccaggagcacctgcagg acgcacaaacaaagcactcatgcatattctgcgtacatttacaagattaagaaggagctg tctgttctcgtgagtgacgcctctttgatgcggcacctgtccggtgcgcaggcgcaggtg tgtgccgaggccgcgcgactctccaagttcaaccggcggcacgtcatcacgcagcgagag ttgtccgccgccgcgcgcgcgctccggcaccgaagctcgtga

DBGET integrated database retrieval system