Carassius auratus (goldfish): 113066088 Help Entry 113066088         CDS       T07313                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism caua  Carassius auratus (goldfish) Pathway caua04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:caua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113066088  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:caua04121]     113066088    03400 DNA repair and recombination proteins [BR:caua03400]     113066088 Ubiquitin system [BR:caua04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113066088    Cul5 complex      113066088 DNA repair and recombination proteins [BR:caua03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113066088 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  113066088 NCBI-ProteinID:  XP_026093500 UniProt:  A0A6P6M9X6 LinkDB All DBs Position 49:complement(6080551..6082747) Genome browser AA seq 112 aa AA seqDB search MDVEERTYGGCEGPDAMHVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRFTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatgttgaagagcggacttatggtggttgtgaaggcccagatgctatgcatgtgaag ctgatctcttcagatggccatgagtttattgtgaagagagagcatgctttgacctctggc accatcaaggctatgctgagtggacctggtcagtttgctgaaaatgaaaccaacgaggtg aacttccgggagatcccgtctcatgttctctccaaagtctgcatgtattttacttataaa gtgcgcttcaccaacagctcgacagagatcccagagttccccattgctcctgagattgcc ctggaattgctaatggctgcaaactttctagactgttaa

DBGET integrated database retrieval system