Carassius auratus (goldfish): 113067303 Help Entry 113067303         CDS       T07313                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism caua  Carassius auratus (goldfish) Pathway caua04010   MAPK signaling pathway caua04012   ErbB signaling pathway caua04068   FoxO signaling pathway caua04137   Mitophagy - animal caua04140   Autophagy - animal caua04144   Endocytosis caua04150   mTOR signaling pathway caua04210   Apoptosis caua04218   Cellular senescence caua04370   VEGF signaling pathway caua04371   Apelin signaling pathway caua04510   Focal adhesion caua04540   Gap junction caua04625   C-type lectin receptor signaling pathway caua04810   Regulation of actin cytoskeleton caua04910   Insulin signaling pathway caua04912   GnRH signaling pathway caua04916   Melanogenesis caua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caua00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113067303    04012 ErbB signaling pathway     113067303    04370 VEGF signaling pathway     113067303    04371 Apelin signaling pathway     113067303    04068 FoxO signaling pathway     113067303    04150 mTOR signaling pathway     113067303  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113067303    04140 Autophagy - animal     113067303    04137 Mitophagy - animal     113067303   09143 Cell growth and death    04210 Apoptosis     113067303    04218 Cellular senescence     113067303   09144 Cellular community - eukaryotes    04510 Focal adhesion     113067303    04540 Gap junction     113067303   09142 Cell motility    04810 Regulation of actin cytoskeleton     113067303  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113067303   09152 Endocrine system    04910 Insulin signaling pathway     113067303    04912 GnRH signaling pathway     113067303    04916 Melanogenesis     113067303  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113067303  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caua04131]     113067303   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113067303    04031 GTP-binding proteins [BR:caua04031]     113067303 Membrane trafficking [BR:caua04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     113067303  Endocytosis   Macropinocytosis    Ras GTPases     113067303 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    113067303   Exosomal proteins of colorectal cancer cells    113067303 GTP-binding proteins [BR:caua04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113067303 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  113067303 NCBI-ProteinID:  XP_026095487 Ensembl:  ENSCARG00000049756 UniProt:  A0A6P6JGW9 LinkDB All DBs Position 50:complement(20249940..20274741) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatacgaccccactatagaggactcctac aggaagcaggtggtgattgacggagagacgtgtctcctggacatcttagacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtcttcgccatcaataacaccaagtcctttgaggacattcatcaatacagggaacagatc aagcgggtgaaggactcggatgacgtgcccatggtgctggtgggtaacaagtgtgacctc ccgacccggacggtggacacacggcaagcgcaggagctcgcccgcagctacgggatcccc ttcatcgagacctccgccaaaacacgacagggtgtggaggatgcgttttacacgctggtg cgagagatccgtcagcacaagatgaggaagctgaacccgccggacgagagcggacaggac tgcatgagctgccgctgcgtcgtgtcctga

DBGET integrated database retrieval system