Carassius auratus (goldfish): 113071752 Help Entry 113071752         CDS       T07313                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism caua  Carassius auratus (goldfish) Pathway caua04010   MAPK signaling pathway caua04012   ErbB signaling pathway caua04068   FoxO signaling pathway caua04137   Mitophagy - animal caua04140   Autophagy - animal caua04150   mTOR signaling pathway caua04210   Apoptosis caua04218   Cellular senescence caua04370   VEGF signaling pathway caua04371   Apelin signaling pathway caua04540   Gap junction caua04625   C-type lectin receptor signaling pathway caua04810   Regulation of actin cytoskeleton caua04910   Insulin signaling pathway caua04912   GnRH signaling pathway caua04916   Melanogenesis Brite KEGG Orthology (KO) [BR:caua00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113071752    04012 ErbB signaling pathway     113071752    04370 VEGF signaling pathway     113071752    04371 Apelin signaling pathway     113071752    04068 FoxO signaling pathway     113071752    04150 mTOR signaling pathway     113071752  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113071752    04137 Mitophagy - animal     113071752   09143 Cell growth and death    04210 Apoptosis     113071752    04218 Cellular senescence     113071752   09144 Cellular community - eukaryotes    04540 Gap junction     113071752   09142 Cell motility    04810 Regulation of actin cytoskeleton     113071752  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113071752   09152 Endocrine system    04910 Insulin signaling pathway     113071752    04912 GnRH signaling pathway     113071752    04916 Melanogenesis     113071752  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caua04131]     113071752   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113071752    04031 GTP-binding proteins [BR:caua04031]     113071752 Membrane trafficking [BR:caua04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     113071752  Endocytosis   Macropinocytosis    Ras GTPases     113071752 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113071752   Exosomal proteins of other body fluids (saliva and urine)    113071752   Exosomal proteins of breast cancer cells    113071752   Exosomal proteins of colorectal cancer cells    113071752 GTP-binding proteins [BR:caua04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113071752 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  113071752 NCBI-ProteinID:  XP_026100823 Ensembl:  ENSCARG00000056731 UniProt:  A0A6P6MWR2 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtataagttggttgttgtgggagcaggtggtgttgggaagagtgctttaacc atccagctcattcagaatcactttgtggacgaatatgaccctactattgaggactcttac aggaagcaggtggtgattgacggtgagacatgtctcctggacatcctggacactgcaggt caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt gtctttgccataaataacagcaaatccttcgcagatgtgcatttgtacagagaacagatc aagcgcgtgaaggactctgatgatgttcccatggtcctagtggggaacaagtgtgatttg gccagaacggtggacaccaagcaagctcaggaacttgccagaagctacggcatagagttt gtagaaacttctgccaagaccagacagggagttgaggatgctttttacacccttgtccgt gagatccgacattatcgcatgaaaaagctcaacagtagagaagaccgaaagcagggctgt ctgggcgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system