Carassius auratus (goldfish): 113074218 Help Entry 113074218         CDS       T07313                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism caua  Carassius auratus (goldfish) Pathway caua04060   Cytokine-cytokine receptor interaction caua04218   Cellular senescence caua04620   Toll-like receptor signaling pathway caua04621   NOD-like receptor signaling pathway caua04622   RIG-I-like receptor signaling pathway caua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caua00001]  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113074218  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caua04052]     113074218    00536 Glycosaminoglycan binding proteins [BR:caua00536]     113074218 Cytokines and neuropeptides [BR:caua04052]  Cytokines   Chemokines    113074218 Glycosaminoglycan binding proteins [BR:caua00536]  Heparan sulfate / Heparin   Chemokines    113074218 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  113074218 NCBI-ProteinID:  XP_026102759 Ensembl:  ENSCARG00000047908 UniProt:  A0A6P6N2X1 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKLTVSAFVLLICTVALLSTTEGRPVRPPLRCNCPQMYSAPAIPADKILSLRFFTAGPQC KNEEIIAKMKKGEMCLDPTKDWVISLKEEINKRNIKSQQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaactcacagtatcagctttcgtgcttttgatctgcacagttgcactgctgtccaca acagagggtagacctgttcgcccaccgctacgttgcaactgccctcaaatgtattcagct ccagcaattccagctgataaaatactctcattgaggttttttactgctggaccacaatgt aaaaatgaggagatcattgccaaaatgaagaaaggagagatgtgtcttgatcctacgaaa gactgggtaatttctctcaaagaagaaatcaacaagagaaacatcaagagtcaacaatga

DBGET integrated database retrieval system