Carassius auratus (goldfish): 113076614 Help Entry 113076614         CDS       T07313                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism caua  Carassius auratus (goldfish) Pathway caua04081   Hormone signaling caua04144   Endocytosis caua04150   mTOR signaling pathway caua04270   Vascular smooth muscle contraction caua04310   Wnt signaling pathway caua04350   TGF-beta signaling pathway caua04510   Focal adhesion caua04520   Adherens junction caua04530   Tight junction caua04621   NOD-like receptor signaling pathway caua04625   C-type lectin receptor signaling pathway caua04810   Regulation of actin cytoskeleton caua05100   Bacterial invasion of epithelial cells caua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caua00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     113076614    04350 TGF-beta signaling pathway     113076614    04150 mTOR signaling pathway     113076614   09133 Signaling molecules and interaction    04081 Hormone signaling     113076614  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113076614   09144 Cellular community - eukaryotes    04510 Focal adhesion     113076614    04520 Adherens junction     113076614    04530 Tight junction     113076614   09142 Cell motility    04810 Regulation of actin cytoskeleton     113076614  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     113076614    04625 C-type lectin receptor signaling pathway     113076614   09153 Circulatory system    04270 Vascular smooth muscle contraction     113076614  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113076614    05100 Bacterial invasion of epithelial cells     113076614  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caua04131]     113076614   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113076614    04031 GTP-binding proteins [BR:caua04031]     113076614 Membrane trafficking [BR:caua04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     113076614 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113076614   Exosomal proteins of other body fluids (saliva and urine)    113076614   Exosomal proteins of colorectal cancer cells    113076614   Exosomal proteins of bladder cancer cells    113076614 GTP-binding proteins [BR:caua04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     113076614 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB Motif Other DBs NCBI-GeneID:  113076614 NCBI-ProteinID:  XP_026105090 Ensembl:  ENSCARG00000042285 UniProt:  A0A6P6NNP2 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELIKMKQEPVKPEEGRDMANRICAFGYMECSAKSKDGVREVFEMATRAALQ ARKGKKNNKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcggcgatccgtaagaagctggtgatcgttggtgacggtgcgtgtgggaagacctgt ctgctcatcgtcttcagtaaagaccagttccccgaggtctacgtgcccaccgtcttcgag aactacgtggccgacatcgaggtggacggcaagcaggtggagctagcgctgtgggacacg gcgggtcaggaggactacgaccgtctgcgaccactctcgtacccagacaccgacgtcatc ctcatgtgcttctccatcgacagcccagacagcctggagaacattcctgagaaatggact ccggaagtcaagcatttttgccccaacgttcccataattctggtgggcaacaagaaggac ctgcgcaacgacgaacacacacgccgcgagctcattaagatgaagcaggagcccgtcaag ccggaggagggccgggacatggcaaaccgcatctgtgccttcggatacatggagtgctct gccaagtccaaggacggcgtgcgggaggtgttcgagatggccaccagggcggcgctgcag gcccgcaagggcaagaagaacaacaagtgcctgctgctgtag

DBGET integrated database retrieval system