Carassius auratus (goldfish): 113090438 Help Entry 113090438         CDS       T07313                                  Name (RefSeq) histone H2B.1, sperm-like   KO K11252   histone H2B Organism caua  Carassius auratus (goldfish) Brite KEGG Orthology (KO) [BR:caua00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:caua03036]     113090438   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113090438 Chromosome and associated proteins [BR:caua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113090438 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113090438 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone AlkA_N Motif Other DBs NCBI-GeneID:  113090438 NCBI-ProteinID:  XP_026112052 UniProt:  A0A6P6NT77 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MKASSERSLKSLNTSRRTGWTRKRSTEAYSAYIYKIEKEVSEDVSDAVSLMRRLSDAHAQ MSAEAARLSKFNRRRVITQRELHAAAKKLLMAEI NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaagcatcatctgaaaggagcctgaagtctctgaacacgtccaggagaaccggctgg acgcgcaaacggagtaccgaggcgtattccgcttacatttacaagatcgagaaggaagtg tctgaggacgtgagtgacgccgtctctttgatgcgccgcctgtccgacgcgcacgcgcag atgagcgccgaggccgcgcgactctccaagttcaaccggcgacgcgtcatcacgcagcga gagctgcacgcagccgcgaaaaagctcctgatggctgagatttaa

DBGET integrated database retrieval system