Carassius auratus (goldfish): 113106249 Help Entry 113106249         CDS       T07313                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism caua  Carassius auratus (goldfish) Pathway caua04010   MAPK signaling pathway caua04012   ErbB signaling pathway caua04068   FoxO signaling pathway caua04137   Mitophagy - animal caua04140   Autophagy - animal caua04144   Endocytosis caua04150   mTOR signaling pathway caua04210   Apoptosis caua04218   Cellular senescence caua04370   VEGF signaling pathway caua04371   Apelin signaling pathway caua04510   Focal adhesion caua04540   Gap junction caua04625   C-type lectin receptor signaling pathway caua04810   Regulation of actin cytoskeleton caua04910   Insulin signaling pathway caua04912   GnRH signaling pathway caua04916   Melanogenesis caua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caua00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113106249    04012 ErbB signaling pathway     113106249    04370 VEGF signaling pathway     113106249    04371 Apelin signaling pathway     113106249    04068 FoxO signaling pathway     113106249    04150 mTOR signaling pathway     113106249  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113106249    04140 Autophagy - animal     113106249    04137 Mitophagy - animal     113106249   09143 Cell growth and death    04210 Apoptosis     113106249    04218 Cellular senescence     113106249   09144 Cellular community - eukaryotes    04510 Focal adhesion     113106249    04540 Gap junction     113106249   09142 Cell motility    04810 Regulation of actin cytoskeleton     113106249  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113106249   09152 Endocrine system    04910 Insulin signaling pathway     113106249    04912 GnRH signaling pathway     113106249    04916 Melanogenesis     113106249  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113106249  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caua04131]     113106249   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113106249    04031 GTP-binding proteins [BR:caua04031]     113106249 Membrane trafficking [BR:caua04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     113106249  Endocytosis   Macropinocytosis    Ras GTPases     113106249 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    113106249   Exosomal proteins of colorectal cancer cells    113106249 GTP-binding proteins [BR:caua04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113106249 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  113106249 NCBI-ProteinID:  XP_026123750 Ensembl:  ENSCARG00000000755 UniProt:  A0A6P6PUC4 LinkDB All DBs Position 7:complement(22855074..22860432) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQG CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagttagtggttgttggtgcaggtggcgtgggcaagagcgctctgacc atccagctcattcagaaccactttgttgatgaatacgacccgaccattgaggactcgtat aggaaacaggtggtgattgatggagagacgtgtctgttggatatcttggatactgcaggt caggaagagtacagtgcaatgagagaccagtacatgaggaccggagagggctttctctgt gtctttgccatcaacaataccaagtcttttgaggacattcatcagtacagggaacagatt aagagggttaaagattcagatgatgtgcccatggtgcttgtgggtaataaatgtgactta ccagcacgcactgtggacacaagacaagcccaggaactggcccgcagctacggtattccc tacattgaaacctcagccaagacaagacagggagtggaagatgccttttacactcttgtc cgtgaaatcaggcagcataagctgaggaaactgaacccgccagatgacaatggccaaggc tgtatgaactgccgctgtgtggtgtcatga

DBGET integrated database retrieval system