Carassius auratus (goldfish): 113106980 Help Entry 113106980         CDS       T07313                                  Name (RefSeq) GTPase NRas-like   KO K07828   GTPase NRas Organism caua  Carassius auratus (goldfish) Pathway caua04010   MAPK signaling pathway caua04012   ErbB signaling pathway caua04068   FoxO signaling pathway caua04137   Mitophagy - animal caua04140   Autophagy - animal caua04150   mTOR signaling pathway caua04210   Apoptosis caua04218   Cellular senescence caua04370   VEGF signaling pathway caua04371   Apelin signaling pathway caua04540   Gap junction caua04625   C-type lectin receptor signaling pathway caua04810   Regulation of actin cytoskeleton caua04910   Insulin signaling pathway caua04912   GnRH signaling pathway caua04916   Melanogenesis Brite KEGG Orthology (KO) [BR:caua00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113106980    04012 ErbB signaling pathway     113106980    04370 VEGF signaling pathway     113106980    04371 Apelin signaling pathway     113106980    04068 FoxO signaling pathway     113106980    04150 mTOR signaling pathway     113106980  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113106980    04137 Mitophagy - animal     113106980   09143 Cell growth and death    04210 Apoptosis     113106980    04218 Cellular senescence     113106980   09144 Cellular community - eukaryotes    04540 Gap junction     113106980   09142 Cell motility    04810 Regulation of actin cytoskeleton     113106980  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113106980   09152 Endocrine system    04910 Insulin signaling pathway     113106980    04912 GnRH signaling pathway     113106980    04916 Melanogenesis     113106980  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caua04131]     113106980   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113106980    04031 GTP-binding proteins [BR:caua04031]     113106980 Membrane trafficking [BR:caua04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     113106980  Endocytosis   Macropinocytosis    Ras GTPases     113106980 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113106980   Exosomal proteins of other body fluids (saliva and urine)    113106980   Exosomal proteins of breast cancer cells    113106980   Exosomal proteins of colorectal cancer cells    113106980 GTP-binding proteins [BR:caua04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113106980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  113106980 NCBI-ProteinID:  XP_026124864 Ensembl:  ENSCARG00000010067 UniProt:  A0A6P6PV93 LinkDB All DBs Position 8:2771469..2785394 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNLKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagttagttgttgtgggagcaggtggtgttgggaagagtgctttaacc atccagctcattcaaaatcattttgtggatgaatatgaccctactattgaggactcttac aggaagcaggtggtgattgacggtgagacgtgtctgctggacatcctggacactgcaggt caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt gtctttgccataaacaacctcaaatccttcgccgatgtgcatttgtacagagaacagatc aagcgcgtaaaggactccgatgatgttcccatggtcctagtagggaacaagtgcgatttg gccagaacagtggacaccaagcaagctcaggaacttgccagaagctacggcattgagttt gtagaaacttctgccaagaccagacagggggttgaggacgctttttacaccctcgtccgt gagatccgacattatcgcatgaaaaagctcaacagcagagaagacaggaagcagggctgt ctgggtgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system