Carassius auratus (goldfish): 113111002 Help Entry 113111002         CDS       T07313                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism caua  Carassius auratus (goldfish) Pathway caua04137   Mitophagy - animal caua04140   Autophagy - animal caua04144   Endocytosis caua04145   Phagosome caua04148   Efferocytosis caua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caua00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113111002    04145 Phagosome     113111002    04140 Autophagy - animal     113111002    04137 Mitophagy - animal     113111002    04148 Efferocytosis     113111002  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113111002  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caua04131]     113111002   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caua04147]     113111002    04031 GTP-binding proteins [BR:caua04031]     113111002 Membrane trafficking [BR:caua04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     113111002 Exosome [BR:caua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113111002   Exosomal proteins of other body fluids (saliva and urine)    113111002   Exosomal proteins of colorectal cancer cells    113111002   Exosomal proteins of bladder cancer cells    113111002 GTP-binding proteins [BR:caua04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     113111002 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  113111002 NCBI-ProteinID:  XP_026131149 Ensembl:  ENSCARG00000067216 UniProt:  A0A6P6QC90 LinkDB All DBs Position 11:10427663..10437623 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAEACSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttcttctgaaggtgatcattcttggagactctggggttggg aagacatctctgatgaaccagtatgtgaataagaagttcagtaatcagtacaaagctact ataggggcagatttcctgacaaaagaagtgatggttgatgaccgacttgtcacaatgcag atatgggacacagcaggtcaagagcgcttccagtctctgggtgtggctttctaccgcggt gccgactgctgtgtgctggtgttcgacgtcactgccccaaacaccttcaagacactggac agctggagagacgagtttctcatccaggccagcccgcgcgacccagagaacttccccttc gtggtgctgggcaacaaaatcgatctggagaacaggcaggtaacaactaagcgggcacag gcttggtgtcagagtaagaacaacatcccgtattttgagaccagtgcaaaggaggccatc aacgtagagcaggctttccagaccatcgcgcgcaatgcactcaaacaggaaactgaagtg gagttatacaacgagttccctgagccaattaaactagaccggaacgatagagccaagcca tcagcagaggcttgcagctgctga

DBGET integrated database retrieval system