Carassius auratus (goldfish): 113114193 Help Entry 113114193         CDS       T07313                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism caua  Carassius auratus (goldfish) Pathway caua04010   MAPK signaling pathway caua04068   FoxO signaling pathway caua04081   Hormone signaling caua04114   Oocyte meiosis caua04140   Autophagy - animal caua04150   mTOR signaling pathway caua04810   Regulation of actin cytoskeleton caua04910   Insulin signaling pathway caua04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:caua00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113114193    04068 FoxO signaling pathway     113114193    04150 mTOR signaling pathway     113114193   09133 Signaling molecules and interaction    04081 Hormone signaling     113114193  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113114193   09143 Cell growth and death    04114 Oocyte meiosis     113114193   09142 Cell motility    04810 Regulation of actin cytoskeleton     113114193  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     113114193    04914 Progesterone-mediated oocyte maturation     113114193  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caua04052]     113114193 Cytokines and neuropeptides [BR:caua04052]  Neuropeptides   Unclassified    113114193 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  113114193 NCBI-ProteinID:  XP_026136784 Ensembl:  ENSCARG00000032535 UniProt:  A0A6P6QTH6 LinkDB All DBs Position 14:complement(27054278..27055853) Genome browser AA seq 107 aa AA seqDB search MVLLLQAAALVLLLASLPGSLSTPSQHLCGSNLVDALYLVCGPRGFFYSSRSRRDLETLL ALLSNLADYEVAEADPLKQKVMKMKRGIVERCCHRPCTIYQLEDYCS NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggtcctgttgctccaggcagcagcattagtcctgctgctggcctccctgcctggatca ctctctactccatctcagcatctgtgcggctccaacctggtggacgcgctttaccttgtg tgtgggcctagaggcttcttttactccagcagaagcaggagggacctggagactttgctg gccttgctctcaaatttagcagattacgaagtagctgaggctgatcctttaaagcagaag gtgatgaagatgaagagagggattgtggaacggtgctgccacaggccctgcaccatctac cagctggaagactactgcagctga

DBGET integrated database retrieval system