Caulobacter sp. NIBR1757: AMEJIAPC_02091 Help Entry AMEJIAPC_02091    CDS       T10944                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism caub  Caulobacter sp. NIBR1757 Pathway caub00998   Biosynthesis of various antibiotics caub01100   Metabolic pathways caub01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caub00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMEJIAPC_02091 (acpP_1)    00074 Mycolic acid biosynthesis     AMEJIAPC_02091 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMEJIAPC_02091 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WGM39176 LinkDB All DBs Position 2132377..2132616 Genome browser AA seq 79 aa AA seqDB search MSDILERVRKIVIEHLDADPEKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFITEKTGG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacattctcgagcgtgtgcgtaagatcgtcatcgaacatctcgatgccgatccc gagaaggtcaccgagaaggcgagcttcatcgatgacctgggcgccgacagcctcgacaac gttgagctggtgatggcgttcgaagaggagttcgacatcgaaatccccgacgacgccgcc gaacacatccaaacggtcggtgacgccgtgaagttcatcacggagaagaccggcggctaa

DBGET integrated database retrieval system