Caulobacter sp. FWC26: CSW63_09850
Help
Entry
CSW63_09850 CDS
T05901
Name
(GenBank) acetolactate synthase 3 large subunit
KO
K01652
acetolactate synthase I/II/III large subunit [EC:
2.2.1.6
]
Organism
cauf
Caulobacter sp. FWC26
Pathway
cauf00290
Valine, leucine and isoleucine biosynthesis
cauf00650
Butanoate metabolism
cauf00660
C5-Branched dibasic acid metabolism
cauf00770
Pantothenate and CoA biosynthesis
cauf01100
Metabolic pathways
cauf01110
Biosynthesis of secondary metabolites
cauf01210
2-Oxocarboxylic acid metabolism
cauf01230
Biosynthesis of amino acids
Module
cauf_M00019
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
cauf_M00570
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:
cauf00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00650 Butanoate metabolism
CSW63_09850
00660 C5-Branched dibasic acid metabolism
CSW63_09850
09105 Amino acid metabolism
00290 Valine, leucine and isoleucine biosynthesis
CSW63_09850
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
CSW63_09850
Enzymes [BR:
cauf01000
]
2. Transferases
2.2 Transferring aldehyde or ketonic groups
2.2.1 Transketolases and transaldolases
2.2.1.6 acetolactate synthase
CSW63_09850
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TPP_enzyme_C
TPP_enzyme_M
TPP_enzyme_N
POR_N
Motif
Other DBs
NCBI-ProteinID:
AZS20924
LinkDB
All DBs
Position
complement(1763556..1765361)
Genome browser
AA seq
601 aa
AA seq
DB search
MTAHQTIESQAPTETNDRAMTGAEIVVRGLVDQGVEVLFGYPGGAVLPIYDALFHEPRLQ
HILVRHEQGAAHAAEGYARSSGKPGVVLVTSGPGATNAITGIMDALMDSIPMVVITGQVP
THLIGTDAFQEADTVGMTRSCTKHNYLVKDVRDLPQIIHEAFKIATTGRPGPVLIDIPKD
VQFAKGEYYGPTEVASSHAYAPRTKGDAGRIADAARMIAQARRPIFYTGGGVINAGPKAS
AALREFAALTGAPVTSTLMGLGAFPAADPAWLGMLGMHGTFEANNAMHDCDVMICVGARF
DDRVTGRLDAFSPGSKKIHIDIDPSSINKNVRVDLPIVGDAGSVLEDLIAAWKAANLQPN
KAALSDWWAQIDQWRARQCLAYRRSDSVIKPQYAIERLYELTKDKDVYITTEVGQHQMWA
AQFFRFEQPNRWMTSGGLGTMGYGLPAALGVQLAHPSSLVVDIAGEASIQMCIQELSTAI
QFDLPVKIFILNNEWMGMVRQWQQLLHGERYSHSYSDSLPDFVKLAEAYGAVGIRCDDPA
ELDAKILEMINSDKPVIFDCRVEKHENCLPMIPSGKAHNEMIMGEVEDIGNVIGEDGAGL
V
NT seq
1806 nt
NT seq
+upstream
nt +downstream
nt
atgaccgcccaccagaccatcgagagccaagctccgaccgaaaccaacgatcgcgccatg
accggcgccgagattgtggttcgcggcctcgtggaccagggcgtcgaggtgcttttcggc
tatcccggcggcgcggtcctcccgatctatgacgcgctgttccacgagccgcgcctgcag
cacattctcgtccgtcacgagcaaggcgcagcccacgcggccgagggctacgcccgcagc
tcgggcaagccgggcgtcgtcctggtcacctcgggtcccggcgcgaccaacgccatcacc
ggcatcatggacgccctgatggactcgatcccgatggtcgtcatcaccggtcaggtcccg
acgcacctgatcggcacagacgccttccaggaagctgatacggttggcatgacccgctcg
tgcaccaagcacaactacctggtcaaagacgtccgcgacctgccgcagatcatccatgag
gccttcaagatcgccaccaccggccgccccggcccggtgctgatcgacatccccaaggac
gttcagttcgccaagggcgaatactacggtccgaccgaagtcgcctcaagccacgcctat
gcgccgcgcaccaaaggcgacgcggggcggatcgcagacgccgctagaatgatcgcccag
gcccgccgtccgatcttctacaccggcggcggcgtcatcaacgccggtcccaaggccagc
gcagctctgcgcgagttcgccgccctcaccggcgcaccggtcacctcgacgctgatgggc
ctgggcgccttcccggcagccgatccggcctggctgggcatgctgggcatgcacggcacc
ttcgaggccaacaacgccatgcacgattgcgacgtgatgatctgcgtcggcgcgcggttc
gatgatcgcgtcacgggccgcctcgacgccttctcgccgggcagcaagaagatccacatc
gacatcgacccgtcgtcgataaacaagaacgtccgcgtcgacctgccgatcgtcggcgac
gccggctcggtcctggaagacctgatcgccgcctggaaagccgcgaacctgcagcccaac
aaggccgccctgagcgactggtgggcccagatcgaccagtggcgcgcgcgccagtgcctc
gcctatcgccgctctgactcggtcatcaagccacagtacgccatcgagcgcctgtatgag
ctgaccaaggacaaagacgtctacatcaccacggaagtcggtcagcaccagatgtgggcc
gcgcagttcttccgcttcgagcagccgaaccgctggatgacctccgggggcctgggcacc
atgggctacggcctgcccgccgccctgggcgtgcagctggcccaccccagcagcctggtc
gtcgacatcgccggcgaagcgtcgatccagatgtgcatccaggagctgtcgaccgcgatc
cagttcgatctgccggtcaagatcttcattctgaacaacgaatggatgggcatggtccgc
caatggcagcaactgctgcacggcgagcgctacagccactcctattcggacagcctgccc
gactttgtgaagctggctgaggcctacggcgcggtcggcatccgctgcgacgacccggcg
gaactggacgccaagattctggagatgatcaacagcgacaagccggtgatcttcgactgc
cgtgtcgagaagcacgagaactgcctgccgatgatcccgtcgggcaaggcgcacaacgaa
atgatcatgggcgaggttgaggatatcggcaacgtcatcggcgaggacggcgcggggttg
gtctaa
DBGET
integrated database retrieval system