Caulobacter sp. FWC26: CSW63_11780 Help Entry CSW63_11780       CDS       T05901                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cauf  Caulobacter sp. FWC26 Pathway cauf01100   Metabolic pathways cauf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cauf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSW63_11780    00074 Mycolic acid biosynthesis     CSW63_11780   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSW63_11780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AZS21269 LinkDB All DBs Position 2151819..2152055 Genome browser AA seq 78 aa AA seqDB search MSDILERVRKIVIEHLDADPEKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFITEKTA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtccgacattctcgagcgcgtgcgtaagatcgtcatcgagcacctggatgccgatccc gagaaggtcaccgagaaggcttccttcatcgacgacctgggcgccgacagcctcgacaac gttgagctggtgatggcgttcgaagaagagttcgacatcgaaattccggacgacgccgcc gagcacatccaaacggtcggcgacgccgtgaagttcatcacggaaaagaccgcctaa

DBGET integrated database retrieval system