Phenylobacterium montanum: KCG34_00910 Help Entry KCG34_00910       CDS       T07744                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism caul  Phenylobacterium montanum Brite KEGG Orthology (KO) [BR:caul00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:caul03032]     KCG34_00910    03036 Chromosome and associated proteins [BR:caul03036]     KCG34_00910    03400 DNA repair and recombination proteins [BR:caul03400]     KCG34_00910 DNA replication proteins [BR:caul03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     KCG34_00910 Chromosome and associated proteins [BR:caul03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     KCG34_00910 DNA repair and recombination proteins [BR:caul03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       KCG34_00910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF2267 HU-CCDC81_bac_2 FANC_SAP Motif Other DBs NCBI-ProteinID:  QUD88486 UniProt:  A0A975IWK9 LinkDB All DBs Position 184431..184703 Genome browser AA seq 90 aa AA seqDB search MTKAELISAIAEKAGLNKNQSRDALEAFLGAVTDSLKAGKEVRLVGFGSFLPVERKAGTA RNPRTGETVKRPASKTARFRVGEGLKGALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacgaaagccgaactgatttctgcaatcgcggaaaaggcggggctcaacaaaaatcag tcgcgagacgccctcgaagcgttcctgggggcggtcacggactccctgaaggcgggcaag gaagtccggctggtgggctttggcagcttcctgccggtcgagcgcaaggcgggtacggcg cgcaacccgcgcaccggcgaaacggtcaagcggccggcctcgaagaccgcgcgcttccgg gtgggcgaggggctgaaaggcgccttgaactaa

DBGET integrated database retrieval system