Phenylobacterium montanum: KCG34_02485 Help Entry KCG34_02485       CDS       T07744                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism caul  Phenylobacterium montanum Pathway caul01100   Metabolic pathways caul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KCG34_02485    00074 Mycolic acid biosynthesis     KCG34_02485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KCG34_02485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QUD88774 UniProt:  A0A975G0Y8 LinkDB All DBs Position 531802..532047 Genome browser AA seq 81 aa AA seqDB search MIPIDQVYGKLTDVFRDVFEDDELEPTPEMTAEDVDGWTSLAHVRLVLTIEEAFGIRFSA AQVSSMANVGDLATTIQKKLS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgattccgatcgatcaggtctatggcaagctgaccgatgtcttccgcgacgtgttcgag gacgacgagctcgagcccacgccggaaatgaccgcagaggacgtggacgggtggaccagc ctggcgcacgtacgtctcgttttgaccatcgaggaagccttcggcattcgcttttcggcg gctcaggtctcgtccatggccaacgtgggcgatctcgccacgacgatccagaagaagcta tcctga

DBGET integrated database retrieval system