Phenylobacterium montanum: KCG34_03705 Help Entry KCG34_03705       CDS       T07744                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism caul  Phenylobacterium montanum Pathway caul01100   Metabolic pathways caul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KCG34_03705    00074 Mycolic acid biosynthesis     KCG34_03705   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KCG34_03705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L50 DUF7080 Motif Other DBs NCBI-ProteinID:  QUD89002 UniProt:  A0A975G1T7 LinkDB All DBs Position complement(813498..813737) Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIEHLDADPEKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFIDERLGA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacactctcgaacgcgtgcgtaagatcgtgatcgagcacctggacgccgatccg gagaaggtcactgaaaaggcctccttcatcgacgacctgggcgccgacagcctcgacaac gtcgagctggtcatggccttcgaagaagagttcgatatcgaaatcccggatgacgccgcc gagcatatccagacggtcggcgatgcggtgaagttcatcgacgagcgcctgggcgcctga

DBGET integrated database retrieval system