KEGG   Phenylobacterium montanum: KCG34_06490
Entry
KCG34_06490       CDS       T07744                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
caul  Phenylobacterium montanum
Pathway
caul00190  Oxidative phosphorylation
caul01100  Metabolic pathways
caul02020  Two-component system
caul04148  Efferocytosis
Module
caul_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:caul00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KCG34_06490 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KCG34_06490 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    KCG34_06490 (petA)
Enzymes [BR:caul01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     KCG34_06490 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: QUD89525
UniProt: A0A975G1R9
LinkDB
Position
1471857..1472399
AA seq 180 aa
MMTPMDGTLATYDEPVRRDFIHILAATAVAGAGAACLWPLIDQMNPAADTLALASIEVDY
SKVALGQQIVVKWRGKPVFVRHRTPAEIAAAVAGDHADLRDPATDASRHKPGMADWLIVI
GVCTHLGCVPLFGQGEFGGWFCPCHGSVYDTSGRIRKGPAPKNLYLPDYAFEPAGKVKIG
NT seq 543 nt   +upstreamnt  +downstreamnt
atgatgacccctatggacgggaccctggccacttacgatgagccggtcaggcgcgatttc
atccatatcctggcggcaaccgcagtcgccggcgccggagcggcttgcctttggccgctg
atcgaccagatgaacccggccgcggacaccctcgccctggcgtcgattgaggtcgactac
agcaaggtggcgctcggccaacagatcgtcgtcaagtggcgcggcaagccggttttcgtg
cgacatcggacaccggcggaaatcgccgccgccgtggccggcgaccacgccgatcttcgc
gatccggcgaccgacgccagccggcacaagccgggcatggcggactggctgatcgtgatc
ggggtgtgcacccacctgggctgtgtgccgttgttcggccagggagaattcggcggctgg
ttttgtccctgccacggctcggtctacgacacgtccggccgcatccgcaaaggcccggcg
ccgaagaatttgtatctgccagactacgccttcgagccggccggcaaggtcaagatcggt
tga

DBGET integrated database retrieval system