Clostridium felsineum DSM 793: CLAUR_012660 Help Entry CLAUR_012660      CDS       T08241                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism caun  Clostridium felsineum DSM 793 Pathway caun01100   Metabolic pathways caun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLAUR_012660 (acpP_2)    00074 Mycolic acid biosynthesis     CLAUR_012660 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLAUR_012660 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Dehyd-heme_bind Motif Other DBs NCBI-ProteinID:  URZ01277 LinkDB All DBs Position complement(1393403..1393636) Genome browser AA seq 77 aa AA seqDB search MLEKIIEYISDYQGISKDKLSKDTKLIQDLDMSSIDMMQMCAEVEEEYGIEMPIAEIYEV ETIGDVALLVEKYINIK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgttagagaaaataatagagtatataagtgattaccaaggaattagtaaagacaaactg tctaaagatacaaaacttattcaggatttggacatgtcatctatagatatgatgcagatg tgtgcagaggttgaagaagagtatggaattgaaatgccaattgctgaaatttatgaggtt gaaacaatcggagatgttgctttactagttgaaaaatatataaatataaaatga

DBGET integrated database retrieval system