Candidozyma auris: CJI96_0001966 Help Entry CJI96_0001966     CDS       T04850                                  Name (RefSeq) hypothetical_protein   KO K09481   protein transport protein SEC61 subunit beta Organism caur  Candidozyma auris Pathway caur03060   Protein export caur04141   Protein processing in endoplasmic reticulum caur04145   Phagosome Brite KEGG Orthology (KO) [BR:caur00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CJI96_0001966    04141 Protein processing in endoplasmic reticulum     CJI96_0001966  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CJI96_0001966  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caur04131]     CJI96_0001966   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:caur02044]     CJI96_0001966 Membrane trafficking [BR:caur04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     CJI96_0001966 Secretion system [BR:caur02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    CJI96_0001966 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  40028721 NCBI-ProteinID:  XP_028890799 LinkDB All DBs Position 2:join(1090223..1090225,1090277..1090549) Genome browser AA seq 91 aa AA seqDB search MSSSAVAPGGLRSAAKRKNAASKKNKEAKEQPLSTRAAGAGGSSATMLKLFTDEAQGLRV DPLVVLFLAVGFIFSVIILHVFAKVSGKFFS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtcttcctctgcagtggccccaggcggcttgagaagtgctgctaaaagaaagaatgct gcctccaagaagaacaaggaagctaaagaacagcccttgtccacgagagccgctggcgct ggtggttcttcggccaccatgttgaagcttttcacagatgaggctcagggtttgagagta gatccattggttgttcttttcttggctgtcggttttatcttctccgtcattatcttgcac gttttcgccaaagtctccggcaagttcttttcttaa

DBGET integrated database retrieval system