Corylus avellana (European hazelnut): 132168590 Help Entry 132168590         CDS       T09426                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism cave  Corylus avellana (European hazelnut) Pathway cave03083   Polycomb repressive complex cave04120   Ubiquitin mediated proteolysis cave04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cave00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132168590    04120 Ubiquitin mediated proteolysis     132168590   09126 Chromosome    03083 Polycomb repressive complex     132168590  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cave04131]     132168590    04121 Ubiquitin system [BR:cave04121]     132168590    03036 Chromosome and associated proteins [BR:cave03036]     132168590 Membrane trafficking [BR:cave04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     132168590 Ubiquitin system [BR:cave04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      132168590    Cul7 complex      132168590 Chromosome and associated proteins [BR:cave03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      132168590   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      132168590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  132168590 NCBI-ProteinID:  XP_059435567 LinkDB All DBs Position ca2:complement(1442045..1442990) Genome browser AA seq 137 aa AA seqDB search MSSSSKKITLKSSDGEAFEVDEAVALESPTIKDDCAENVIPLPDVTSKILAKVIEYCKKH VKAQATNPDNRTSDDDLKAWDAELVQLDTDTLFCLIQSLVDLIRQTVADMTMIKEMTPAA ECEVLSCIVCLGLLYEA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcgtcgaagaagatcaccctgaagagctcggacggcgaagccttcgaggtc gacgaggcggtggcgctcgagtcgccgacgatcaaggacgattgcgccgaaaacgtaatc cccctcccggacgtgacaagcaagatcttggccaaggtcatcgagtactgcaagaagcac gtcaaggctcaggcgacgaaccccgacaaccgcacctccgatgacgatctcaaggcctgg gacgccgagctcgtccagcttgacacggacactctattctgtctcattcagagccttgtg gatctgatacgccaaactgtagcagacatgaccatgatcaaggagatgacaccggcggca gaatgtgaagttttaagttgcatagtttgtttgggtttattatatgaggcgtag

DBGET integrated database retrieval system