Corylus avellana (European hazelnut): 132183713 Help Entry 132183713         CDS       T09426                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism cave  Corylus avellana (European hazelnut) Pathway cave04016   MAPK signaling pathway - plant cave04070   Phosphatidylinositol signaling system cave04075   Plant hormone signal transduction cave04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:cave00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     132183713    04070 Phosphatidylinositol signaling system     132183713    04075 Plant hormone signal transduction     132183713  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     132183713  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cave01009]     132183713   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cave04131]     132183713    03036 Chromosome and associated proteins [BR:cave03036]     132183713   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cave04147]     132183713 Protein phosphatases and associated proteins [BR:cave01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      132183713 Membrane trafficking [BR:cave04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     132183713 Chromosome and associated proteins [BR:cave03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      132183713 Exosome [BR:cave04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    132183713 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH DUF6240 SPARC_Ca_bdg Caleosin UPF0154 EF_EFCAB10_C Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  132183713 NCBI-ProteinID:  XP_059453089 LinkDB All DBs Position ca6:24343624..24346287 Genome browser AA seq 105 aa AA seqDB search MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ NGTIDFSEFLNLMARKMKVSSIQCQSISYCLFYRALDYYFIELAN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccgagcagctcacggaggagcagatcgcagagttcaaggaagccttcagtctcttc gacaaggacggcgatggctgtattactaccaaagagttggggacagtcatgagatctttg ggccaaaatcccaccgaagctgaactgcaggatatgatcaatgaagttgatgctgatcaa aatggcactattgatttctctgagtttctgaatttgatggcacggaaaatgaaggtgagc tcaattcaatgtcaatcaatatcatactgcttattttacagagcacttgactattacttt attgagctagctaattaa

DBGET integrated database retrieval system