Corylus avellana (European hazelnut): 132187756 Help Entry 132187756         CDS       T09426                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism cave  Corylus avellana (European hazelnut) Pathway cave04136   Autophagy - other Brite KEGG Orthology (KO) [BR:cave00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     132187756  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cave04131]     132187756    04121 Ubiquitin system [BR:cave04121]     132187756    03029 Mitochondrial biogenesis [BR:cave03029]     132187756 Membrane trafficking [BR:cave04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     132187756 Ubiquitin system [BR:cave04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    132187756 Mitochondrial biogenesis [BR:cave03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     132187756 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 DUF4264 Motif Other DBs NCBI-GeneID:  132187756 NCBI-ProteinID:  XP_059458158 LinkDB All DBs Position ca7:10607707..10614703 Genome browser AA seq 94 aa AA seqDB search MAADSPSSVRKVVVHLRATGDAPILKQAKFKIPGTDKFAKVIDFLCRQLHRETLFVYVNS AFSPNPDELVIDLYNNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctgctgattctccgagttctgtacgaaaagtggttgttcatctcagagcaactggc gatgcgcctatactcaaacaagccaaattcaagattcctggaactgacaagtttgctaaa gtgattgactttctatgccggcagcttcatcgggaaacattgtttgtctatgtcaacagt gcattctcaccaaacccagatgaattggtaattgatctgtataataattttggttttgat ggtaagctggtggtcaattatgcttgttccatggcatggggctaa

DBGET integrated database retrieval system