Corylus avellana (European hazelnut): 132188588 Help Entry 132188588         CDS       T09426                                  Name (RefSeq) GTP-binding protein SAR1B-like   KO K07953   GTP-binding protein SAR1 [EC:3.6.5.-] Organism cave  Corylus avellana (European hazelnut) Pathway cave04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cave00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132188588  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cave04131]     132188588   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:cave04031]     132188588 Membrane trafficking [BR:cave04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Coat protein complex II (COP-II)     132188588 GTP-binding proteins [BR:cave04031]  Small (monomeric) G-proteins   Arf/Sar Family    Sar     132188588 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf G-alpha MMR_HSR1 Roc SRPRB Gtr1_RagA Ras PduV-EutP Motif Other DBs NCBI-GeneID:  132188588 NCBI-ProteinID:  XP_059459109 LinkDB All DBs Position ca1:complement(14653585..14655946) Genome browser AA seq 117 aa AA seqDB search MFLFDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELS IGKIKFKAFDLGGHQIARRVWKDYYAKVDAVIYLVDAYDKERFAESKKELDGLLSDE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgttcctctttgattggttctatggggtgctcgcatcgctgggcctatggcagaaggag gccaagattcttttcttgggtctcgacaatgctggcaagaccacccttcttcacatgttg aaagacgagagactagtgcaacaccagccgacccagcaccccacgtcggaggagctgagt attgggaaaatcaagttcaaggctttcgatttgggtggccaccagatcgctcgcagagtc tggaaagattactatgctaaggtggatgcagtgatttaccttgttgatgcttatgacaag gagaggtttgcagaatcaaaaaaggagctggatggcctcctttcagatgaa

DBGET integrated database retrieval system