KEGG   Corylus avellana (European hazelnut): 132192364
Entry
132192364         CDS       T09426                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial-like
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
cave  Corylus avellana (European hazelnut)
Pathway
cave00220  Arginine biosynthesis
cave00250  Alanine, aspartate and glutamate metabolism
cave00270  Cysteine and methionine metabolism
cave00330  Arginine and proline metabolism
cave00350  Tyrosine metabolism
cave00360  Phenylalanine metabolism
cave00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cave00710  Carbon fixation by Calvin cycle
cave00950  Isoquinoline alkaloid biosynthesis
cave00960  Tropane, piperidine and pyridine alkaloid biosynthesis
cave01100  Metabolic pathways
cave01110  Biosynthesis of secondary metabolites
cave01200  Carbon metabolism
cave01210  2-Oxocarboxylic acid metabolism
cave01230  Biosynthesis of amino acids
Module
cave_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cave_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cave00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    132192364
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    132192364
   00270 Cysteine and methionine metabolism
    132192364
   00220 Arginine biosynthesis
    132192364
   00330 Arginine and proline metabolism
    132192364
   00350 Tyrosine metabolism
    132192364
   00360 Phenylalanine metabolism
    132192364
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    132192364
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    132192364
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    132192364
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cave01007]
    132192364
Enzymes [BR:cave01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     132192364
Amino acid related enzymes [BR:cave01007]
 Aminotransferase (transaminase)
  Class I
   132192364
SSDB
Motif
Pfam: Aminotran_1_2 LpxI_C
Other DBs
NCBI-GeneID: 132192364
NCBI-ProteinID: XP_059463665
LinkDB
Position
ca9:22605775..22609407
AA seq 434 aa
MWRFMGGRFSRSTRCISSSSRAFGWWEHVSPAPKDPITGVTEAFLADTNPNKINLGVGAY
RDDQGKPVVLQCVRNAEAKIAACEFLESNAAAVGSKLVEESAKLAYGTQAHVVKEGRVAG
LQALSGTGACRLFAELQRRFYPGSPIYLPDPTWSNHHNIWRDAQVPERSFRYYNPITKGL
DFAALMDDVKTAPDGSFFLFHPCAHNPTGVDPTEEQWREISYQFKVKNHFPFFDMAYQGF
ATGDLDMDAQAIRIFLEDGHLIGCAQSFAKNMGLYGHRVGCLSVLCADEKQAVAVKSQLQ
QIARSMYSNPPVHGILLVSTILNDPQTKALWVKEVKVMANRIQLMRATLRERLEDLGSPL
DWENITNQVGMFCFSGLTPDQVDRLVREFHIYMTRDGRISIAGVTTSNVSYLASAIHEVT
KYDQEASNIYNISI
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtggaggttcatggggggaagatttagtagatcaacgaggtgcatttcgagctcaagc
agggcctttggatggtgggagcatgtgagcccagcccctaaggaccccatcactggcgta
accgaggcttttcttgctgacaccaaccccaacaagatcaatcttggagtgggagcttac
agggacgatcaagggaaaccagttgttcttcaatgtgttcgaaatgcggaggcaaagatt
gctgcttgcgagtttctggagtcaaatgcggctgcagtgggttcaaagttggtggaggag
agtgcgaaactggcttatggaacacaggcccatgtcgtaaaagaagggagggtggctgga
cttcaagcgctctctggtactggtgcgtgtcgtctctttgctgagcttcagaggcgtttc
tatcctggatcaccaatttatttacctgatccaacttggtccaaccaccacaatatatgg
agagatgcccaagttccagaaagaagcttccgttactacaatcccattacaaagggttta
gactttgcagctctcatggatgatgtcaagactgccccagatggttcttttttcttgttt
catccatgtgctcacaacccaactggggttgaccctactgaggaacagtggagggaaatc
tcatatcaatttaaggtaaagaatcactttcccttctttgacatggcttatcaaggtttt
gcaaccggagatcttgacatggatgcccaagcaatccgtatttttcttgaagacggacat
ctgatcggctgtgctcaatccttcgccaaaaacatgggattatatggacaccgagttggt
tgtctcagtgtcctatgtgctgatgagaagcaagcagttgcagttaaaagccaactgcag
cagattgccaggtcgatgtacagcaatcctcctgttcatggtatattgctggtctccaca
atcttaaatgatccacagaccaaggcactttgggtcaaagaggtgaaggtcatggcgaat
cgcattcaactaatgcgggctactctgcgtgaacgtcttgaggatttgggttctcctctc
gactgggagaacataactaaccaggttggcatgttttgcttctctggcttaacacctgat
caggttgatcggctagtcagggaattccacatatatatgactcgagatggacgaataagc
attgcaggtgtaactacaagcaatgtgagttacttggcaagtgcgatacatgaagttaca
aaatatgatcaagaagcctccaatatctataacattagtatttaa

DBGET integrated database retrieval system