Carnobacterium inhibens: Q783_05855 Help Entry Q783_05855        CDS       T02884                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism caw  Carnobacterium inhibens Pathway caw01100   Metabolic pathways caw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Q783_05855    00074 Mycolic acid biosynthesis     Q783_05855   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Q783_05855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  AGY81801 UniProt:  U5S9S6 LinkDB All DBs Position complement(1222887..1223117) Genome browser AA seq 76 aa AA seqDB search MTFEKIQAIIVDQLDKEEEEVQLETNFREDLEADSLDLFQIINDIEDEFDIKIESEEGLN TVQDIVTFVEAELAKK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgacattcgaaaaaattcaagcaattatcgtggaccaattagacaaagaggaagaagaa gtacaattagaaacaaatttccgtgaagatctagaagcagacagcttagacttattccaa atcatcaatgatatcgaagatgaatttgatatcaagatcgaatctgaagaaggtttaaat acggttcaagatatcgtaacttttgttgaagctgaattagctaaaaaataa

DBGET integrated database retrieval system