Corynebacterium atypicum: CATYP_05295 Help Entry CATYP_05295       CDS       T03227                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism cax  Corynebacterium atypicum Pathway cax03060   Protein export cax03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:cax00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CATYP_05295  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CATYP_05295  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cax02044]     CATYP_05295 Secretion system [BR:cax02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CATYP_05295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF6167 Motif Other DBs NCBI-ProteinID:  AIG64138 LinkDB All DBs Position 1126745..1127008 Genome browser AA seq 87 aa AA seqDB search MPNLGGWELLIIVLVIVLLFGAKKLPDAARSLGRSMRIFRSEVKEMGNDDAPSAEQKQIS AVDHGTDQEAQAPQVNVKNPQGTEQER NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgccaaacctcggtggctgggaactgctcatcatcgtcctcgtgatcgtgttgctcttc ggcgcgaagaagcttcctgatgccgcgcgctcgctggggcgctctatgcgcatcttccgc tccgaggtcaaggaaatgggtaatgacgacgccccctcggccgagcagaagcagatttct gccgtagaccacggcaccgatcaggaggcgcaggcgccacaggtgaacgtgaagaacccc cagggcaccgagcaggagcgctag

DBGET integrated database retrieval system