Cereibacter azotoformans: LV780_14600 Help Entry LV780_14600       CDS       T07975                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism cazt  Cereibacter azotoformans Brite KEGG Orthology (KO) [BR:cazt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cazt03036]     LV780_14600    03400 DNA repair and recombination proteins [BR:cazt03400]     LV780_14600 Chromosome and associated proteins [BR:cazt03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     LV780_14600 DNA repair and recombination proteins [BR:cazt03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       LV780_14600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF6491 Motif Other DBs NCBI-ProteinID:  UIJ30506 LinkDB All DBs Position 1:complement(2919111..2919389) Genome browser AA seq 92 aa AA seqDB search MKLNIERLTRDELIDLYGRISAALDACESRQIARKAKEEAARIKGEAGESGKRVSYFNPT NRSVSWNGRGRCPHWFKVAMAQGRTPEELAAL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagttgaacattgagcggttgactcgggacgaacttatagacctctacggtcggatt tccgcggcactggatgcctgcgaaagccgtcaaatcgccagaaaggcgaaagaagaggcc gcaaggatcaagggcgaggcaggagagagcggaaagagggtgagttacttcaaccccacc aaccgctccgtttcatggaacgggcgcgggcgctgcccgcactggttcaaggtcgccatg gcgcagggccgcacgccggaagaactggcggcgctctga

DBGET integrated database retrieval system