Clostridium botulinum A ATCC 19397: CLB_3720 Help Entry CLB_3720          CDS       T00574                                  Symbol ssb Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism cba  Clostridium botulinum A ATCC 19397 Pathway cba03030   DNA replication cba03430   Mismatch repair cba03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cba00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     CLB_3720 (ssb)    03430 Mismatch repair     CLB_3720 (ssb)    03440 Homologous recombination     CLB_3720 (ssb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cba03032]     CLB_3720 (ssb)    03400 DNA repair and recombination proteins [BR:cba03400]     CLB_3720 (ssb)    03029 Mitochondrial biogenesis [BR:cba03029]     CLB_3720 (ssb) DNA replication proteins [BR:cba03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CLB_3720 (ssb) DNA repair and recombination proteins [BR:cba03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      CLB_3720 (ssb)   TLS (translesion DNA synthesis) factors    Other SOS response factors     CLB_3720 (ssb) Mitochondrial biogenesis [BR:cba03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     CLB_3720 (ssb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB tRNA_anti-codon SSB_1 Motif Other DBs NCBI-ProteinID:  ABS32386 LinkDB All DBs Position complement(3846638..3847084) Genome browser AA seq 148 aa AA seqDB search MNKVVLIGRLTKDPELKFTPGNGTAVATFTLAVDRRFSKDGQREADFIPIVVWGKQAEST ANYMSKGKLMGVSGRIQTRSYEAKDGTRRYVTEVIAEEVKFLEWGNKPTTDSTYNNGSEP SYQSGQGFGNGNSFDDDIIPVDDGDIPF NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgaataaagttgttttgataggtagattaaccaaagatcctgagttaaaatttactcca ggaaacgggacagcagttgccacctttactttggctgtagatagaagattttcaaaagat ggtcagagagaagcagatttcatccctatagtagtatggggaaaacaagcagaatctaca gctaactacatgagtaaaggaaaacttatgggggttagtggtagaattcaaacaagaagc tatgaagctaaagatggtacaagaagatatgtaacagaagtcatagcggaagaagttaaa tttcttgagtggggcaataagcctacaacggattcaacatataataatgggtcagaacca agttatcaatcaggccaaggctttggaaatggaaacagttttgacgacgatataattcca gtggatgatggagacatcccattttaa

DBGET integrated database retrieval system